PATENTES, DESENHOS INDUSTRIAIS, CONTRATOS, PROGRAMAS DE COMPUTADOR,
INDICAÇÕES GEOGRÁFICAS, TOPOGRAFIA DE CIRCUITO INTEGRADO
REVISTA DA PROPRIEDADE INDUSTRIAL No 2109
07 de Junho de 2011
SEÇÃO I
REPÚBLICA FEDERATIVA DO BRASIL
Presidente
Dilma Roussef
MINISTÉRIO DO DESENVOLVIMENTO, INDÚSTRIA E COMÉRCIO EXTERIOR
Ministro do Desenvolvimento, Indústria e Comércio Exterior
Fernando Pimentel
INSTITUTO NACIONAL DA PROPRIEDADE INDUSTRIAL
PRESIDENTE
Jorge de Paula Costa Ávila
VICE-PRESIDENTE
Ademir Tardelli
CHEFE DE GABINETE
Josefina Sales de Oliveira
DIRETORIA DE ARTICULAÇÃO E INFORMAÇÃO
TECNOLÓGICA
Sergio Medeiros Paulino de Carvalho
PROCURADORIA GERAL
Mauro Sodré Maia
DIRETORIA DE PATENTES
Carlos Pazos Rodrigues
DIRETORIA DE MARCAS
Terezinha de Jesus Guimarães
DIRETORIA DE TRANSFERÊNCIA DE TECNOLOGIA
Breno Bello de Almeida Neves
DIRETORIA DE ADMINISTRAÇÃO E SERVIÇOS
Julio Cesar Dutra De Oliveira
REVISTA DA PROPRIEDADE INDUSTRIAL
Órgão Oficial do INSTITUTO NACIONAL DA
PROPRIEDADE INDUSTRIAL
Lei nº 5648, de 11.12.70 art. 9º e decreto nº 68.104, de
22.01.71, art. 24
SEDE DO INPI
MV - Mayrink Veiga nº 9, Centro - CEP: 20090-910
PM – Praça Mauá nº 7, Centro - CEP: 20081-240
Tel.: PABX (21) 2139-3000
PROCURADORIA
MV – 22º andar
Tel.: (21) 2139-3207
Fax: (21) 2139-3206
DIRMA – Diretoria de Marcas
MV – 27º andar
Tel.: (21) 2139-3217
Fax: (21) 2139-3347
Central de atendimento: (0XX-21) 2139-3158
DIRPA – Diretoria de Patentes
MV – 20º andar
Tel.: (21) 2139-3715
Fax: (21) 2139-3194
DIRTEC – Diretoria de Transferência de Tecnologia
Praça Mauá, nº 7 – 12º andar
Tel.: (21) 2139-3645, 2139-3115
Fax: (21) 2139-3175
DAS – Diretoria de Administração e Serviços
MV – 3º andar
Tel.: (21) 2139-3105, 2139-3123
Fax: (21) 2139-3228
DART - Diretoria de Articulação e Informação Tecnológica
MV – 27º andar
Tel.: (21) 2139-3130
Fax: (21) 2139-3529
DIVISÕES REGIONAIS
BRASÍLIA
Chefe: Antonio Carlos Pereira Coelho
e-mail: [email protected]
SAS - Quadra 2, Lote 1/A
Brasília - DF - CEP: 70070-020
Tel. : (61) 3224-1114
Horário de Atendimento: 10h às 16h30
CEARÁ
Chefe: Alberto Moreira da Rocha
e-mail: [email protected]
Rua Doutor Mário Martins Coelho, nº 36
Aldeota - Fortaleza - CE - CEP: 60170-280
Tel.: (85) 3261-1372, 3261-1695
Fax: (85) 3268-1495
Horário de Atendimento: 10h às 16h30
MINAS GERAIS
Chefe: José Renato Carvalho Gomes
e-mail: [email protected]
Avenida Amazonas nº 1.909
Santo Agostinho - Belo Horizonte - MG - CEP: 30180-002
Tel.: (31) 3291-5614, 3291-5623
Fax: (31) 3291-5449
Horário de Atendimento: 10h às 16h30
PARANÁ
Chefe: Renee Fernando Senger
e-mail: [email protected]
Rua Marechal Deodoro, 344, 16º andar
Edifício Atalaia, Centro, Curitiba - PR
CEP: 80010-909
Telefone: (41) 3322-4411
Horário de Atendimento: 10h às 16h30
Edifício Arábica – 3° andar – salas 312, 314 e 316
Enseada do Suá - Vitória - ES - CEP: 299055-907
Tel.: (27) 3235-7788
Fax: (27) 3315-9823
Horário de Atendimento: 10h às 16h30
Goiás
Responsável: Rosemar Rodrigues de Oliveira Marinari
JUNTA COMERCIAL DO ESTADO DE GOIÁS
Rua 206 - Esquina 259 - Setor Universitário, Quadra 84, Lt.
5 à 8 Goiânia – GO CEP:74640-310
Tel.: (62) 3202-2246, 3202-2262, 3261-4833 Ramal: 279
Horário de Atendimento: 8h às 18h
RIO GRANDE DO SUL
Chefe: Maria Isabel de Toledo Andrade Cunha
e-mail: [email protected]
e-mail: [email protected]
Av. José de Alencar, 521 – Cobertura 902 – Bairro Menino
Jesus. Porto Alegre - RS - CEP: 90880-481
Telefone: (51) 3226-6909, 3226-6422, 3227-5886
Horário de Atendimento: 10h às 16h30
Maranhão
Responsável: Déa Lourdes Furtado de Oliveira
Secretaria de Estado da Indústria e Comércio
Av. Carlos Cunha s/n° - sala 210
Edifício Nagib Haickel – Calhau/ MA - CEP: 65065-180
Telefone: (98) 3235-8546, ramais 28 e 29
Horário de Atendimento: após às 13h
SÃO PAULO
Chefe: Maria dos Anjos Marques Buso
e-mail: [email protected]
Rua Tabapuã, 41 - 4º andar - Itaim-Bibi
São Paulo - SP - CEP: 04533-010
Telefone:(11) 3071-3434, 3071-3433
Horário de Atendimento: 10h às 16h30
Mato Grosso
Responsável: Kenner Langner da Silva
Junta Comercial do Estado do Mato Grosso - JUSSEMAT
Av. Historiador Rubens de Mendonça, s/nº - CPA
Cuiabá/ MT - CEP: 78055-500
Tel.: (65) 3613-9520, 3613-9528
Horário de Atendimento: 8h às 12h
14h às 17h00
REPRESENTAÇÕES E POSTOS AVANÇADOS
Acre
Responsável: Amoísio Severiano Freitas
Secretaria de Desenvolvimento Ciência e Tecnologia
BR-364, Km 5, Zona A – Setor 3 Lote “1-A” –
Distrito Industrial - Rio Branco/ Acre - CEP: 69.917-100
Tel./FAX : (68) 3229-6349, 3229-4259, 3229-5556
Horário de Atendimento: 8h às 12h
14h às 17h30
Alagoas
Responsável: Jarbas Agostinho dos Santos
Secretaria do Desenvolvimento Econômico
Av. Da Paz, N.1108 - Centro
Maceió /AL - CEP: 57022-050
Tel.: (82) 3315-1721, 3315-1719, 3315-1720
Horário de Atendimento: 8h às 16h30
Amapá
Responsável: Rosenilda Creuza Silva de Souza
Junta Comercial
Av FAB, 1610 – Centro
Macapá/ AP - CEP: 68906-030
Tel.: (96) 3225-8650
Fax: (96) 3225-8654
Horário de Atendimento: 7h30 às 13h30
Amazonas
Responsável: Aliete Velloso da Silva
SEPLAN – Secretaria do Estado de Planejamento e
Desenvolvimento Econômico
Rua Major Gabriel, 1870 – Praça 14 de Janeiro
Manaus /AM - CEP: 69060-060
Tel.: (92) 2126-1235, 2126-1200
Bahia
Responsável: Flavio José Moreno
Rua Pedro R. Bandeira, 143 – 5º andar
Cidade Baixa – Salvador – Bahia
CEP: 40015-080
Tel.: (71) 3326-9597, 3242-5223
Horário de Atendimento: 10h às 16h30
Responsável: Isis Patrícia Motta
Av. Otávio Mangabeira, 6929 – Multi Shop Boca do Rio
CEP: 41715-000
Tel.: (71) 3281-4148
Horário de Atendimento: 8h às 16h30
Espírito Santo
Responsável: Edilamar Gonzaga
Rua Abigail do Amaral Carneiro, 191
Mato Grosso do Sul
Responsável: Clenira Brandão de Souza
Secretaria de Estado de Desenvolvimento Agrário, da
Produção, da Indústria, do Comércio e do
Turismo/SEPROTUR
Av. Desembargador José Nunes da Cunha-Parque dos
Poderes, Bloco 12 – CEP: 79031-310 – Campo
Grande/MS
Telefone: (67) 3318-5013
Horário de Atendimento: 7h30 às 13h30
Pará
Responsável: Paulo Fernando Campos Maciel
SEDECT – Secretaria Estado de Desenvolvimento Ciência
e Tecnologia
Av. Presidente Vargas, 1020 – Campina
Belém /PA - CEP: 66017-000
Telefone: (91) 4009-2534, 4009-2531
Horário de Atendimento: 8h às 13h
14h às 16h
Responsável: Francisco Montandon Guilhermino
SEFA – Secretaria Estadual da Fazenda
Av. Mendonça Furtado, 2797 – Fátima
Santarém /PA - CEP: 68005-020
Telefone: (93) 3063-5634
Horário de Atendimento: 8h30 às 13h
Paraíba
Responsável: Aline Nascimento Duarte
Secretaria de Turismo e Desenvolvimento Econômico
Rua Feliciano Cisne n° 50 – Jaguaribe
João Pessoa/PB - CEP: 58015-570
Telefone: (83) 3208-3922, 3208-3923, 3242-2545/2729
Horário de Atendimento: 12h às 16h30
Pernambuco
Responsável: Eduardo Andrade Bemfica
e-mail: [email protected]
Universitária Federal de Pernambuco - UFPE
Av. Prof. Moraes Rego, 1235 – Campus Universitário
Bairro - Engenho do Meio
Recife/PE - CEP: 50670-920
Telefone: (81) 3453-8145, 3271-1223
Horário de Atendimento: 10h às 16h30
Piauí
Responsável: Eliane Fatima Assunção Lima Souza
Secretaria de Desenvolvimento Econômico e Tecnológico
Rua Rui Barbosa, n° 805 – Centro – Central-Fácil/SEBRAE
Telefone: (86) 3216-3000 ramal 1403
Representações e Postos Avançados
Horário de Atendimento: 7h30 às 13h30
Rio Grande do Norte
Responsável: Kátia R. Maia
Secretaria de Desenvolvimento Econômico e Tecnológico
BR 101 - Km 94 - 1 º andar - Lagoa Nova
Natal /RN - CEP: 59064-901
Telefone: (84) 3232-1723
Rio de Janeiro
Responsável: Eliane Taveira
ASSINF – Av. Alberto Braune, nº 111 Térreo
Nova Friburgo/RJ - CEP: 28613-001
Telefone: (22) 2522-1145, 2522-8452
Horário de Atendimento: 10h às 16h
Responsável: Ledio Ferreira
Associação Comercial e Empresarial de Petrópolis
Rua Irmãos D’Angelo, nº 48 – 7º andar
Petrópolis/RJ - CEP: 25685-330
Telefone: (24) 2237-1101
Horário de Atendimento: 9h às 11h
13h às 18h
Rondônia
Responsável: Elismarcia da Silva de Oliveira
Av. Pinheiro Machado, nº 326 – Caiari
Porto Velho /RO – CEP: 78900-050
Telefone: (69) 3216-8603
Horário de Atendimento: 8h às 14h
Roraima
Responsável: Cezar Augusto dos Santos Rosa Junior
Av. Jaime Brasil, 157 - Centro
Boa Vista/ RR - CEP: 69301-350
Tel.: (95) 2121-5370
Horário de Atendimento: 7h30 às 13h30
Santa Catarina
Responsável: Angela Terezinha de Seixas Scozziero
e-mail: [email protected]
Rua Felipe Schimidt, nº 515 – 11º andar – Ático - Centro
Florianópolis /SC - CEP: 88010-001
Tel.: (48) 3223-5227, 3223-4827
Fax.: (48) 3223-4827
Horário de Atendimento: 10h às 16h30
Sergipe
Responsável: Dione Pujals
SEBRAE/SE
Av. Tancredo Neves, n° 5.500 – Bairro América
Aracajú /Sergipe – CEP: 49080-480
Tel.: (79) 2106-7751
PABX: (79) 2106-7700
Tocantins
Responsável: Aitimem Salim
Secretaria da Indústria e Comércio do Estado doTocantins
Esplanada das Secretarias - Praça dos Girassóis, snº Palmas /TO - CEP: 77003-900
Telefone: (63) 3218-2032
Horário de Atendimento: 8h às 12h
14h às 18h
Esta Publicação é de responsabilidade da Coordenação
Geral de Tecnologia da Informação
Telefone: (21) 2139-3447
Índice Geral
RPI 2109 de 07/06/2011
Comunicados
5
Ministério do Desenvolvimento, Indústria e Comércio Exterior
-
Presidência do INPI
9
DIRETORIA DE PATENTES
Exame Formal Preliminar – Índice Remissivo por Depositante
-
Exame Formal Preliminar – Índice Numérico Remissivo
-
Exigências Decorrentes do Exame Formal Preliminar
-
Tabela de Códigos de Despachos e Códigos INID de Pedidos, Patentes (incluindo as de MI/DI
expedidas na vigência da Lei 5772/71) e Certificados de Adição de Invenção
11
Tabela de Códigos de Despachos de Pedidos e Patentes (incluindo as de MI/DI expedidas na
vigência da Lei 5772/71) - Período de Transição (Lei 5772/71)
17
Índice Numérico Remissivo de Pedidos, Patentes e Certificados de Adição de Invenção
19
Notificação - Fase Nacional - PCT e Publicação de Pedidos de Patente e de Certificado de
Adição de Invenção
23
Despachos Relativos a Pedidos, Patentes (incluindo as de MI/DI expedidas na vigência de
Lei 5772/71) e Certificados de Adição de Invenção
123
Pipeline - Publicação para Manifestação de Terceiros
-
Pipeline - Comunicação de Depósito e Despachos Relativos a Pedidos e Patentes
-
Despachos Relativos a Pedidos e Patentes - Período de Transição (Lei 5772/71)
-
DIRETORIA DE CONTRATOS, INDICAÇÕES GEOGRÁFICAS E REGISTROS
Tabela de Códigos de Despachos e Códigos INID de Pedidos e Registros de Desenho Industrial
147
Índice Numérico Remissivo de Pedidos e Registros de Desenho Industrial
149
Publicação de Desenhos Industriais
151
Despachos Relativos a Pedidos e Registros de Desenho Industrial
185
Tabelas de Códigos de Despacho em Contratos de Tecnologia e Outros Registros
189
Despachos em Contratos de Tecnologia e em Licença de Uso de Marca
193
Despachos em Registros de Programas de Computador
197
Despachos - Indicações Geográficas
-
Despachos - Registro de Topografia de Circuito Integrado
-
PROCURADORIA
Estatísticas
199
Código Internacional de Países e Organizações
205
De conformidade com a Lei nº 5.648, de 11 de dezembro de 1970, esta é a publicação oficial do Instituto Nacional da Propriedade Industrial, órgão vinculado ao Ministério do
Desenvolvimento, Indústria e Comércio Exterior, República Federativa do Brasil, que publica todos os seus atos, despachos e decisões relativos ao sistema de propriedade
industrial no Brasil, compreendendo Marcas e Patentes, bem como os referentes a contratos de Transferência de Tecnologia e assuntos correlatos, além dos que dizem respeito
ao registro de programas de computador como direito autoral.
As established by Law nº 5.648 of december 11, 1970, this is the official publication of the National Institute of Industrial Property, an office under the Ministry of Development,
Industry and Foreign Trade, Federative Republic of Brazil, which publishes all its official acts, orders and decisions regarding the industrial property system in Brazil, comprising
Trademarks and Patents, as well as those refering to Technology Transfer agreements and related matters, besides those regarding software registering as copyright.
D´après la Loi nº 5.648 du 11 décembre 1970, celle-si est la publication officielle de I'Institut National de la Propriété Industrielle, un office lié au Ministère du Développement, de
I’Industrie et du Commerce Extérieur, République Fédérative du Brésil, qui publie tous ses actes, ordres et décisions concernant le système de la propriété industrielle au Brésil,
y compris marques et brevets, aussi que ceux référents aux contracts de transfert de technologie et des sujets afférents, en outre que ceux se rapportant à l'enregistrement des
programmes d´ordinateur comme droit d'auteur.
Según estabelece la Ley nº 5.648 de 11 diciembre 1970, esta es la publicación oficial del Instituto Nacional de la Propiedad Industrial, oficina vinculada al Ministerio del
Desarrollo, Industria y Comercio Exterior, República Federativa del Brasil, que publica todos sus actos, ordenes y decisiónes referentes al sistema de propiedad industrial en
Brasil, comprendendo marcas y patentes así que los referentes a contractos de transferencia de tecnologia y asuntos corelacionados, además de los referentes al registro de
programas de ordenador como derecho de autor.
Laut Gezets Nr. 5.648 vom 11. dezember 1970, ist dies das Amtsblatt des Nationalen Instituts für gewerbliches Eigentum (INPI), eines Organs des Bundesministerium für
Entwicklung, Industrie und Aussenhandel, der Bundesrepublik Brasilien, welches alle Amtshandlungen, Beschlüsse und Entscheidungen über gewerbliches Eigentum in
Brasilien, einschliesslich Warenzeichen und Patente, ebenso wie auch Übertragunsvertrage von Technologie und Computerprogramme als Urheberrecht veroffentlicht.
Representações e Postos Avançados
Comunicados
RPI 2109 de 07/06/2011
INSTRUÇÕES PARA OS
PAGAMENTOS E COMPROVAÇÃO
DAS RETRIBUIÇÕES.
Leia com atenção
1- Será desconsiderado qualquer procedimento cujo pagamento em cheque não tenha sido compensado
em tempo hábil.
2- Não serão aceitas fichas de compensação (guias) com rasuras em qualquer das vias.
3- Fichas de compensação (guias) recolhidas, originalmente, para determinado serviço não poderão ser
utilizadas para outra finalidade. O interessado deverá solicitar restituição do valor não utilizado.
4- O pagamento da retribuição deverá ser feito de acordo com a tabela vigente na data da publicação do
pedido ou ato a que se referir.
5- Alertamos sobre a mensagem constante nas fichas de compensação (guias) sobre a necessidade de
autenticação bancária das 2(duas) vias.
6- Solicitamos aos usuários que façam o recolhimento das guias de pagamento, preferencialmente, nas
agências do Banco do Brasil S/A.
COMPLEMENTO
7- No caso de Processo em tramitação, é obrigatório a menção do número do processo; data; código da
natureza do serviço e nome do interessado na guia de recolhimento
A ADMINISTRAÇÃO
Instituto Nacional da Propriedade Industrial
Comissão de Cadastramento de Agentes da Propriedade Industrial
(Portaria INPI/PR 272 de 18/04/2011)
RPI 2109 de 07/06/2011
Comunicado
Em conformidade com a Resolução n° 194/08,
de 21/11/08, publicada na RPI 1979, de 09/12/08,
ficam os interessados, a seguir relacionados, na
data desta publicação, cientes dos despachos e
decisões proferidas pela Comissão constituída pela
Port. INPI/PR Nº 272 de 18/04/11, junto aos seus
requerimentos de Cadastramento como Agente da
Propriedade Industrial.
Instituto Nacional da Propriedade Industrial
Comissão de Cadastramento de Agentes da Propriedade Industrial
(Portaria INPI/PR 272 de 18/04/2011)
RPI 2109 de 07/06/2011
1 - RESTAURAÇÃO DO CADASTRAMENTO
Matrícula: 0507
Interessado: Francisco Carlos Rodrigues Silva
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0521
Interessado: Benedita Aparecida Rodrigues
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0668
Interessado: Gerson Tertuliano Gomes
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0740
Interessado: Ivana Campos Mendes dos Santos
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0778
Interessado: Alexsandra Gomes Raquel
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0810
Interessado: Wagner José Fafá Borges
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 0838
Interessado: Milton Lucídio Leão Barcellos
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 1012
Interessado: Rejane Caggiano
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 1128
Interessado: Joane Raquel Nunes da Silva
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 1288
Interessado: Mariângela Vassalo
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Instituto Nacional da Propriedade Industrial
Comissão de Cadastramento de Agentes da Propriedade Industrial
(Portaria INPI/PR 272 de 18/04/2011)
RPI 2109 de 07/06/2011
Matrícula: 1614
Interessado: Pedro José Gomes da Silva
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 1760
Interessado: Cidwan Uberlândia
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 1828
Interessado: Marcella Britto Freire Bonadiu
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 2039
Interessado: Gustavo Bahuschewskyj
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
Matrícula: 2055
Interessado: Ideiativa Propriedade Intelectual Ltda.
Despacho: Restaurado o cadastramento nos termos da Resolução 194/08, art. 13.
2 - ANOTAÇÃO DE ALTERAÇÃO DE NOME
Matrícula: 1828
Interessado: Marcella Souza Gomes de Britto Freire
Nome anterior: Marcella Britto Freire Bonadiu
3 - DEFERIMENTO EM CONFORMIDADE COM A RESOLUÇÃO 194/08 DE 21/11/08
(adotado o nº do processo de requerimento como matrícula).
Matrícula: 2101
Interessado: Leão Propriedade Intelectual
INPI - Presidência
RPI 2109 de 07/06/2011
NULIDADES E RECURSOS AO SR. PRESIDENTE DO INPI
DIRPA
RECURSOS
(21) PI 9711876-1 A2 (22) 30/09/1997
(71) Dyadic International (USA), Inc.
(US)
(74) Nellie Anne Daniel Shores
Recorrente: O depositante.
Despacho: Cumpra as exigências do
parecer técnico.[121]
(21) PI 9903330-5 A2 (22) 20/07/1999
(71) Universidade de São Paulo - USP
(BR/SP)
(74) Paulo Roberto Trautevein Gil
Recorrente: O depositante.
Despacho: Cumpra as exigências do
parecer técnico.[121]
(21) PI 9815548-2 A2 (22) 31/07/1998
(71) Kos Life Sciences, Inc. (US)
(74) Cruzeiro Newmarc Patentes e
Marcas Ltda.
Requerente da Devolução de Prazo:
KOS LIFE SCIENCES, INC.
Despacho: Concedida a devolução de
prazo de 30 (trinta) dias, a partir desta
notificação.[140]
(21) PI 9915939-2 A2 (22) 01/12/1999
(71) Sanofi-Aventis (FR)
(74) Dannemann, Siemsen, Bigler &
Ipanema Moreira
Requerente da Devolução de Prazo:
SANOFI - AVENTIS
Despacho: Concedida a devolução de
prazo de 51 (cinquenta e um dias)
dias, a partir desta notificação.[140]
Diretoria de Patentes - DIRPA
Tabela de Códigos de Despachos de Pedidos, Patentes
(incluindo as de MI/DI expedidas na vigência da Lei
5772/71) e Certificados de Adição de Invenção
RPI 2109 de 07/06/2011
1. Pedido Internacional
PCT/BR Designado ou Eleito
2. Depósito
2.1
1.1
Notícias da Publicação Internacional
Comunicação da publicação internacional do
pedido internacional nos termos do Tratado de
Cooperação de Patente - PCT, aguardando o
início da fase nacional, folheto em idioma
original encontra-se à disposição dos
interessados no Banco de Patentes do INPI.
1.1.1 Retificação
Retificação da notificação da publicação
internacional por ter sido efetuada com
incorreção.
1.2
1.2.1
Pedido Retirado
Comunicação da perda do efeito do pedido
internacional no Brasil: por retirada do pedido
ou da designação pelo depositante; pelo
pedido internacional ter sido considerado
retirado em virtude dos artigos 12 (3), 14 (1)
(b), 14 (3) (a) ou 14 (4) do PCT; se a
designação do Brasil é considerada retirada
em virtude do artigo 14 (3) (b); se o
depositante não cumpriu as determinações
referentes à entrada do pedido na fase
nacional, isto é, não apresentação do pedido
na fase nacional dentro dos prazos
estabelecidos pelo artigo 22 ou 39 do PCT,
conforme o caso.
1.3
2.4
Publicação Anulada
Anulação da publicação da retirada do pedido
por ter sido indevida.
1.2.2 Republicação
Republicação da publicação da retirada do
pedido por ter sido efetuada com incorreção.
Notificação - Fase Nacional - PCT
Notificação da entrada na fase nacional do
pedido internacional depositado através do
Tratado de Cooperação de Patentes - PCT. O
prazo para requerimento do pedido de exame
é contado a partir da data do depósito
internacional. Não sendo o exame requerido,
pelo depositante ou qualquer interessado, no
prazo de 36 (trinta e seis) meses do depósito
internacional, o pedido será arquivado.
Publicado o arquivamento do pedido, poderá
ser requerido, no prazo de 60 (sessenta) dias,
o seu desarquivamento. Não sendo requerido
o desarquivamento no prazo anteriormente
citado,
o
pedido
será
considerado
definitivamente arquivado. Os interessados
podem adquirir no Banco de Patentes do
CEDIN/INPI o folheto com o relatório
descritivo, reivindicações, desenhos e resumo
do pedido, tanto em sua forma original quanto
em sua versão em português.
2.5
Notificação de Depósito de Pedido de
Patente ou de Certificado de Adição de
Invenção
Notificação de depósito de pedido de patente
ou de certificado de adição de invenção. O
pedido de patente será mantido em sigilo
durante 18 (dezoito) meses a contar da data
da prioridade mais antiga. Decorrido esse
prazo, será publicado para conhecimento
público. O depositante pode, porém, requerer
a antecipação da publicação. O prazo de sigilo
de 18 (dezoito) meses para o pedido de
Certificado de Adição de Invencão é contado
da data do depósito do pedido principal.
Quando houver ocorrido a publicaçao do
pedido principal, o pedido de Certificado de
Adição de Invencão será imediatamente
publicado. Os depósitos são designados de
acordo com a natureza requerida: Invenção
(PI), Modelo de Utilidade (MU) e Certificado de
Adição de Invencão (C ). Os pedidos
depositados através do PCT são notificados
no subitem 1.3.
Notificação de Depósito do Pedido Dividido
Notificação de pedido dividido de um pedido
de patente depositado anteriormente. Em
relação ao pedido original, o pedido dividido
tem a mesma data de depósito e, se for o
caso, o correspondente benefício da
prioridade reivindicada. O pedido dividido é
considerado como estando na mesma fase
processual do pedido original.
Exigência - Art. 21 da LPI
O pedido requerido pela petição citada não
atende formalmente ao disposto no art. 19 da
LPI e/ou às demais disposições quanto à sua
forma, tendo sido recebido provisoriamente.
Não tendo sido possível uma ciència ao
interessado diretamente no processo ou por
via postal, fica o requerente obrigado a sanar,
em 30 ( trinta ) dias a contar desta data, as
exigências estabelecidas. Não sendo a
exigência cumprida com a apresentação da
documentação correspondente no prazo
acima, o depósito não será aceito e a
documentação ficará à disposição do
interessado.
2.6
Publicação Anulada
Anulada a publicação por ter sido indevida.
2.7
Republicação(*)
Republicação da publicação da notificação de
depósito do pedido por ter sido efetuada com
incorreção.
3.2
Publicação Antecipada
Publicação
do
pedido
depositado,
a
requerimento do depositante. Aplicam-se as
disposições do subitem 3.1.
3.6
Publicação
do
Pedido
Arquivado
Definitivamente - Art. 216 §2º e Art. 17 §2º
da LPI
Publicação
de
pedido
definitivamente
arquivado devido à não apresentação de
procuração ou devido à apresentação de um
pedido posterior
Encerrada a instância
administrativa. Pode ser adquirido no Banco
de Patentes do Centro de Documentação e
Informação Tecnológica do INPI - CEDIN - o
folheto
com
o
relatório
descritivo,
reivindicações, desenhos e resumo do pedido.
3.7
Publicação Anulada
Anulação da publicação do pedido por ter sido
indevida.
3.8
Retificação
Retificação da publicação do pedido por ter
sido efetuada com incorreção que não
impossibilita sua identificação. Tal publicação
não implica na alteração da data de
publicação do pedido de patente e nos prazos
decorrentes da mesma.
4. Pedido de Exame
4.3
3. Publicação do Pedido
3.1
Publicação do Pedido de Patente ou de
Certificado de Adição de Invenção
Publicação do pedido depositado (Art. 30 da
LPI), podendo ser adquirido no Banco de
Patentes do Centro de Documentação e
Informação Tecnológica do INPI - CEDIN - o
folheto
com
o
relatório
descritivo,
reivindicações, desenhos e resumo do pedido,
por quem se interessar. Não sendo o exame
requerido, pelo depositante ou qualquer
Desarquivamento - Art. 33 parágrafo único
da LPI.
Desarquivado o pedido, arquivado por falta de
pedido de exame (cf. item 11.1), para
prosseguir seu andamento.
4.3.1 Publicação Anulada
Anulação da publicação do desarquivamento
do pedido por ter sido indevida.
4.3.2 Republicação
Republicação
da
publicação
do
desarquivamento do pedido por ter sido
efetuada com incorreção.
6.Exigências Técnicas e Formais
6.1
1.3.1 Retificação
Retificação da notificação da fase nacional PCT por ter sido efetuada com incorreção.
1.3.2 Publicação Anulada
Anulação da notificação da entrada na fase
nacional através do PCT por ter sido indevida.
interessado, no prazo de 36 (trinta e seis)
meses do depósito, o pedido será arquivado.
Publicado o arquivamento do pedido, poderá
ser requerido, no prazo de 60 (sessenta) dias,
o seu desarquivamento. Não sendo o
requerido o desarquivamento no prazo
anteriormente
citado,
o
pedido
será
considerado definitivamente arquivado.
Exigência - Art. 36 da LPI
Suspensão do andamento do pedido de
patente
que,
para
instrução
regular,
aguardará o atendimento ou contestação das
exigências formuladas. Caso a exigência não
tenha sido explicitada no despacho da RPI, o
depositante poderá requerer cópia do parecer
através do formulário modelo 1.05. A não
manifestação do depositante no prazo de 90
(noventa) dias desta data acarretará o
arquivamento definitivo do pedido.
12
DIRPA - Tabela de Códigos de Despachos
6.6
Exigência - Art. 34 da LPI
Suspensão do andamento do pedido de
patente para que sejam apresentados todos
os documentos relativos às objeções, buscas
de anterioridade e resultados de exame para
concessão de pedido correspondente em
outros países quando houver reivindicação de
prioridade,
documentos
necessários
à
regularização do processo e exame do pedido,
ou a tradução simples do documento hábil
referido no § 2º do art. 16, caso esta tenha
sido substituída pela declaração prevista no §
5º do mesmo artigo. Caso a exigência não
tenha sido explicitada no despacho RPI, o
depositante poderá requerer cópia do parecer
através do formulário modelo 1.05. A não
manifestação do depositante no prazo de 60
(sessenta) dias desta data acarretará o
arquivamento do pedido.
6.7
Outras Exigências
Outras exigências que não as especificadas
nos subitens anteriores (6.1 e 6.6).
Suspensão do andamento do pedido de
patente que, para instrução regular da patente,
aguardará pelo prazo de 60 (sessenta) dias o
atendimento da exigência formulada. Caso a
exigência não tenha sido explicitada no
despacho da RPI, o depositante poderá
requerer cópia do parecer através do
formulário modelo 1.05.
6.8
Exigência Anulada (**)
Anulação da exigência por ter sido indevida.
6.9
Publicação Anulada
Anulação da publicação da exigência por ter
sido indevida.
6.10
RPI 2109 de 07/06/2011
8.6
8.7
7.3
8.10
Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
8.11
7.4
Ciência relacionada com o art. 229 da LPI
O exame técnico concluiu que o pedido atende
aos requisitos estabelecidos pelos artigos 8 e
36 da LPI. O deferimento do mesmo está
condicionado à obtenção da anuência de que
trata o art. 229 da LPI da Lei 9.279/96,
conforme redação dada pela Lei 10.196/2001
8. Anuidade do Pedido
8.5
Exigência de Complementação de
Anuidade
O depositante deverá complementar, de
acordo com a tabela vigente na data da
complementação,
o
pagamento
da
anuidade especificada, por meio do formulário
modelo
1.02
acompanhado
dos
comprovantes
dos
pagamentos
correspondentes
ao
cumprimento
de
9.2.1 Decisão Anulada (**)
Anulação da decisão de indeferimento do
pedido por ter sido indevida.
9.2.2 Publicação Anulada
Anulada a publicação de indeferimento por ter
sido indevida.
9.2.3 Republicação
Republicação da publicação de indeferimento
por ter sido efetuada com incorreção.
9.2.4 Manutenção do Indeferimento
Mantido o indeferimento uma vez que não foi
apresentado recurso dentro do prazo legal.
9.2.4.1 Publicação Anulada
Anulada a publicação da manutenção do
indeferimento por ter sido indevida
do
Publicação Anulada
Anulada a publicação por ter sido indevida
Manutenção do Arquivamento
Manutenção do Arquivamento Mantido o
arquivamento do pedido uma vez que não foi
requerida a restauração nos termos do
disposto no art. 87 da LPI, encerrando a
instância administrativa.
10.Desistência
10.1
Desistência Homologada
Notificação da homologação da desistência do
pedido de patente, apresentada pelo
depositante, acarretando o encerramento do
processo administrativo.
10.5
Desistência não Homologada
Notificação da não homologação
desistência do pedido de patente.
Deferimento
Deferido o pedido de patente. Desta data corre
o prazo de 60 (sessenta) dias para o
pagamento e comprovação, através do
formulário modelo 1.02, da retribuição para
expedição da carta-patente. O pagamento
desta retribuição poderá ainda ser efetuado
dentro dos 30 (trinta) dias subseqüentes,
independente de notificação na RPI. O não
pagamento e sua comprovação nos prazos
acima
determinados
acarretará
o
arquivamento definitivo do pedido.
9.1.1 Decisão Anulada (**)
Anulação da decisão de deferimento por ter
sido indevida.
da
10.6
Despacho Anulado (**)
Anulação do despacho por ter sido indevido.
10.7
Publicação Anulada
Anulada a publicação por ter sido indevida
10.8
Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
10.9
Retirada Homologada Art. 29 § 1º da LPI
Notificação de homologação da retirada do
pedido de patente, solicitada pelo depositante.
9. Decisão
Conhecimento de Parecer Técnico
Suspenso o andamento do pedido para que o
depositante se manifeste, no prazo de 90
(noventa) dias desta data, quanto ao contido
no parecer técnico. A cópia do parecer técnico
poderá ser solicitada através do formulário
modelo
1.05. A não manifestação ou a
manifestação considerada
improcedente
acarretará a manutenção do posicionamento
técnico anterior.
Republicação
Republicação da publicação de conhecimento
do parecer técnico por ter sido efetuada com
incorreção.
restauração
8.9
Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
Publicação Anulada
Anulada a publicação de conhecimento do
parecer técnico por ter sido indevida.
Restauração
Notificação quanto à
andamento do pedido.
Despacho Anulado (**)
Anulação do despacho por ter sido indevido.
9.1
7.2
Arquivamento - Art. 86 da LPI
Arquivado
o
pedido
por
falta
de
pagamento de anuidade dentro do prazo ou
por não cumprimento de exigência de
complementação de pagamento de anuidade.
Desta
data
corre
o
prazo
de
3
(três) meses para o depositante requerer a
restauração
do
andamento
do
pedido por meio do formulário modelo 1.02
acompanhado
dos
comprovantes
referentes ao pagamento da restauração e
conforme
o
caso:
da
cópia
do
pagamento correspondente a anuidade paga
fora
do
prazo;
do
pagamento
correspondente à anuidade em débito; ou do
pagamento
correspondente
a
complementação
8.8
7. Ciência de Parecer
7.1
patente de invenção ou modelo de utilidade,
nos termos do Art. 76 § 4º da LPI.
exigência e a complementação da anuidade.
O não cumprimento no prazo de 60 (sessenta)
dias acarretará o arquivamento do pedido.
10.9.1 Retirada Não Homologada Art. 29 § 1º da
LPI
Notificação de não homologação da retirada
do pedido de patente.
11. Arquivamento
11.1
9.1.2 Publicação Anulada
Anulada a publicação de deferimento por ter
sido indevida.
Arquivamento - Art. 33 da LPI
Arquivado o pedido uma vez que não foi
requerido o pedido de exame no prazo
previsto no Art. 33 da LPI. Desta data corre o
prazo de 60 (sessenta) dias para o
depositante requerer o desarquivamento,
através do formulário 1.02, mediante
pagamento da retribuição específica de
desarquivamento e do pagamento do pedido
de exame sob pena de arquivamento
definitivo.
9.1.3 Republicação
Republicação da publicação de deferimento
por ter sido efetuada com incorreção.
9.1.4 Retificação
Retificação da publicação de deferimento por
ter sido efetuada com incorreção. Tal
publicação não implica na alteração da data
do deferimento e nos prazos decorrentes da
mesma.
11.1.1 Arquivamento definitivo - Art. 33 da LPI
Arquivado definitivamente o pedido uma vez
que não foi requerido o desarquivamento.
9.2
11.2
Arquivamento - Art. 36 §1° da LPI
Arquivado definitivamente o pedido de
patente, uma vez que não foi respondida a
exigência formulada.
11.4
Arquivamento - Art. 38 § 2° da LPI
Arquivado definitivamente o pedido de
patente, uma vez que não foi comprovado o
pagamento da retribuição de expedição da
carta-patente.
Indeferimento
Indeferido o pedido por não atender aos
requisitos legais, conforme parecer técnico. A
cópia do parecer técnico poderá ser solicitada
através do formulário modelo 1.05. Desta data
corre o prazo de 60 (sessenta) dias para
eventual recurso do depositante. No caso de
pedido de certificado de adição indeferido por
não ter o mesmo conceito inventivo, o
depositante poderá, no prazo de recurso,
requerer a sua transformação em pedido de
RPI 2109 de 07/06/2011
11.5
11.6
DIRPA - Tabela de Códigos de Despachos 13
Arquivamento - Art. 34 da LPI
Arquivado o pedido, uma vez que não foram
atendidas as exigências previstas no Art. 34
da LPI. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
Arquivamento do Pedido-Art. 216 §2° da
LPI
Arquivado definitivamente o pedido de
patente, uma vez que não foi apresentada a
procuração devida no prazo de 60 (sessenta)
dias contados da prática do primeiro ato da
parte no processo.
11.6.1 Arquivamento da Petição-Art. 216 §2º da
LPI
Arquivada a petição, uma vez que não foi
apresentada a procuração devida no prazo de
60 (sessenta) dias contados da prática do ato.
Desta data corre o prazo de 60 (sessenta) dias
para eventual recurso do interessado.
requerida cópia do recurso
formulário modelo 1.05.
através
do
12.7
Publicação Anulada
Anulada a publicação de notificação do
recurso por ter sido indevida.
12.8
Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
15. Outros Referentes a Pedidos
15.7
Petição Não Conhecida
Não conhecimento da petição apresentada em
virtude do disposto nos Arts. 218 ou 219 da
LPI.
11.11 Arquivamento - Art. 17 § 2º da LPI
Arquivado definitivamente o pedido de
patente, uma vez que foi efetuado depósito
posterior nos termos do Art. 17 § 2º da LPI.
15.8
Petição Sustada
Sustado o conhecimento da petição para
aguardar providências necessárias ao seu
conhecimento.
11.12 Art. 26 parágrafo único da LPI
Arquivado o
pedido, uma vez que o
requerimento de divisão está em desacordo
com o disposto no Art. 26 da LPI. Desta data
corre o prazo de 60 (sessenta) dias para
eventual recurso ao depositante.
15.9
11.13 Despacho Anulado (**)
Anulação do despacho de arquivamento do
pedido por ter sido indevido.
11.14 Publicação Anulada
Anulada a publicação de arquivamento do
pedido por ter sido indevida.
11.15 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
11.16 Restauração
Notificação quanto à
andamento do pedido.
restauração
do
11.17 Arquivamento do pedido de Certificado de
Adição de Invenção – Art. 77 da LPI
Arquivado o pedido de Certificado de Adição
de Invenção uma vez que não há uma patente
de invenção da qual o mesmo possa ser
acessório.
Desta data corre o prazo de 60 (sessenta) dias
para eventual recurso do depositante.
12. Recurso
12.2
12.3
12.6
Recurso Contra o Indeferimento
Notificação de interposição de recurso ao
Presidente do INPI contra o indeferimento do
pedido de patente ou do certificado de adição
de invenção, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para apresentação de contrarazões por qualquer interessado. Poderá ser
requerida cópia do recurso através do
formulário modelo 1.05.
Recurso Contra o Arquivamento
Notificação de interposição de recurso ao
Presidente do INPI contra o arquivamento do
pedido de patente, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para apresentação de contrarazões por qualquer interessado. Poderá ser
requerida cópia do recurso através do
formulário modelo 1.05.
Outros Recursos
Notificação de interposição de recurso ao
Presidente do INPI contra a decisão proferida
pela DIRPA, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para apresentação de contrarazões por qualquer interessado. Poderá ser
Perda de Prioridade
Perda da prioridade reivindicada por não
atender às disposições previstas no artigo 16
§ 7º da LPI.
15.24.2 Concedido o exame prioritário do pedido
de patente
Concedido o exame prioritário do pedido de
patente uma vez que o requerimento
apresentado atende ao disposto na Resolução
INPI nº 132/06 de 17/11/06.
15.24.3 Negado o exame prioritário do pedido de
patente
Negado o exame prioritário do pedido de
patente uma vez que o requerimento
apresentado não atende ao disposto na
Resolução INPI nº 132/06 de 17/11/06.
15.30 Publicação Anulada
Anulada a publicação de qualquer um dos
subitens anteriores por ter sido indevida.
15.31 Despacho Anulado (**)
Anulação do despacho referente a qualquer
um dos subitens anteriores por ter sido
indevido.
15.32 Decisão Anulada (**)
Anulação da decisão referente a qualquer um
dos subitens anteriores por ter sido indevida.
15.33 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
16. Concessão de Patente ou
Certificado de Adição
de Invenção
15.10 Mudança de Natureza
Mudada a natureza e alterado o número do
pedido.
15.11 Alteração de Classificação
Alterada a classificação do pedido para melhor
adequação.
16.1
Concessão de Patente ou Certificado de
Adição de Invenção
Expedição da carta-patente ou do certificado
de adição de invenção. O título acha-se à
disposição do interessado no setor
competente do INPI. Desta data corre o prazo
de 6 (seis) meses para interposição de
nulidade administrativa por qualquer
interessado (Art. 51 da LPI ).O certificado de
adição é acessório da patente, tem a data final
de vigência desta e a acompanha para todos
os efeitos legais.
16.2
Publicação Anulada
Anulada a publicação da concessão por ter
sido indevida.
16.3
Retificação
Retificação da publicação da concessão da
patente por ter sido efetuada com incorreção
que não impossibilita sua identificação. Tal
publicação não implica na alteração da data
de publicação da concessão da patente e
nos prazos decorrentes da mesma.
16.4
Concessão Anulada
Anulada a concessão da patente por ter sido
indevida.
15.12 Renumeração
Alterada a numeração por ter sido numerado
indevidamente.
15.14 Notificação de Decisão Judicial
Notificação de decisão judicial referente ao
pedido.
15.21 Numeração Anulada
Anulada a numeração do pedido de patente
15.22 Devolução de Prazo Concedida
Notificação de devolução de prazo uma vez
que não foi possível ciência ao interessado
diretamente no processo. Desta data corre o
prazo adicional concedido no despacho. O
prazo será de, no mínimo 15 (quinze) dias e,
no máximo, o prazo legal dos atos
correspondentes (Art. 221 da LPI e AN 127
item 12).
15.22.1 Devolução de Prazo Negada
Negada a solicitação de devolução de prazo
uma vez que não ficou comprovada a justa
causa conforme definida no Art. 221 da LPI. A
cópia do parecer poderá ser solicitada através
do formulário 1.05. Desta data corre o prazo
de 60 (sessenta) dias para eventual recurso
do interessado.
17.Nulidade Administrativa
15.23 Pedido “SUB JUDICE”
Notificação de ação judicial referente a pedido.
15.24 Notificação de requerimento de exame
prioritário de pedido de patente.
O exame prioritário do pedido de patente só será
iniciado após ter sido atendido o disposto no
parágrafo único do art. 31 da LPI e nos arts. 33 e
84 da LPI, bem como transcorridos 24 meses da
data de seu depósito, para garantir que todos os
pedidosde patente depositados com data
anterior já tenham sido publicados.
15.24.1 Notificação de exame prioritário, de
Ofício, de pedido de patente.
O exame prioritário do pedido de patente só será
iniciado após ter sido atendido o disposto no
parágrafo único do art. 31 da LPI e nos arts. 33 e
84 da LPI, bem como transcorridos 24 meses da
data de seu depósito, para garantir que todos os
pedidos de patente depositados com data anterior
já tenham sido publicados.
17.1
Notificação de Interposição de Nulidade
Administrativa
Notificação, ao titular da patente, de
instauração de processo administrativo de
nulidade. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
titular (Art. 52 da LPI). Poderá ser requerida
cópia do processo de nulidade através do
formulário modelo 1.05.
17.2
Publicação Anulada
Anulação da publicação de notificação da
instauração de processo administrativo de
nulidade por ter sido indevida.
17.3
Republicação
Republicação da publicação de notificação da
instauração de processo administrativo de
nulidade por ter sido efetuada com incorreção.
14
DIRPA - Tabela de Códigos de Despachos
RPI 2109 de 07/06/2011
18. Caducidade
18.1
18.3
18.4
18.5
18.6
Notificação de Pedido de Caducidade
Notificação, ao titular da patente, da
instauração do processo de caducidade por
falta de exploração por requerimento de
terceiros e/ou de ofício. Poderá ser requerida
cópia do processo de caducidade através do
formulário modelo 1.05.
Caducidade Deferida
Declarada a caducidade da patente por falta
de exploração. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do titular
(Art. 212 da LPI). A decisão da caducidade
produzirá efeitos a partir da data do
requerimento ou da publicação da instauração
de ofício do processo. Poderá ser requerida
cópia do parecer através do formulário modelo
1.05.
21.2
Extinção - Art 78 inciso II da LPI
Notificação da extinção da patente e seus
certificados, se for o caso, pela homologação
da renúncia apresentada pelo seu titular.
Homologada a renúncia, a patente será
considerada extinta na data da apresentação
da renúncia.
22.11 Devolução de Prazo
Notificação de devolução de prazo uma vez
que não foi possível ciência ao interessado
diretamente no processo. Desta data corre o
prazo adicional concedido no despacho. O
prazo será de, no mínimo 15 (quinze) dias e,
no máximo, o prazo legal dos atos
correspondentes (Art. 221 da LPI e AN 127
item 12).
Extinção - Art. 78 inciso IV da LPI
Notificação da extinção da patente e seus
certificados, se for o caso, dada a não
restauração prevista no Art. 87 da LPI. A
patente é considerada extinta na data final do
prazo legal (nove meses) do primeiro
pagamento devido que deixou de ser
efetuado.
21.7
Recurso
contra
o
Deferimento
da
Caducidade
Interposição de recurso ao Presidente do INPI
contra o deferimento do pedido de
caducidade, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
interessado. Poderá ser requerida cópia do
recurso através do formulário modelo 1.05.
Extinção - Art. 78 inciso V da LPI
Notificação da extinção da patente e seus
certificados, se for o caso, uma vez que após
solicitação do INPI o titular deixou de
comprovar a obrigação decorrente do Art. 217
da LPI.
22.14 Arquivamento da Petição-Art. 216 §2º da LPI
Arquivada a petição, uma vez que não foi
apresentada a procuração devida no prazo de
60 (sessenta) dias contados da prática do ato.
Desta data corre o prazo de 60 (sessenta) dias
para eventual recurso do interessado.
21.8
Despacho Anulado (**)
Anulação do despacho da extinção da patente
por ter sido indevido.
22.15 Patente “SUB JUDICE”
Notificação de ação judicial referente a
patente.
21.9
Recurso contra o Indeferimento da
Caducidade
Interposição de recurso ao Presidente do INPI
contra o indeferimento do pedido de
caducidade, objetivando o reexame da
matéria. Poderá ser requerida cópia do
recurso através do formulário modelo 1.05.
Publicação Anulada
Anulada a publicação de qualquer um dos
subitens anteriores por ter sido indevida.
21.10 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
Caducidade Indeferida
Denegado o pedido de caducidade da patente.
Desta data corre o prazo de 60 (sessenta) dias
para eventual recurso do interessado (Art. 212
da LPI).Poderá ser requerida cópia do parecer
através do formulário modelo 1.05.
18.13 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
19. Notificação de Decisão Judicial
19.3
Extinção - Art. 78 inciso I da LPI
Notificação da extinção da patente e seus
certificados, se for o caso, pela expiração do
prazo de vigência de proteção legal.
21.6
18.12 Publicação Anulada
Anulada a publicação de qualquer um dos
subitens anteriores por ter sido indevida.
19.2
21.1
22.12 Oferta de Licença de Patente
Notificação de oferta de licença (ou renovação
da mesma) para exploração da patente (Art.
64 § 1º da LPI). O interessado poderá obter
cópia na íntegra das condições contratuais
oferecidas pelo titular (AN 127 item 8),
mediante solicitação através do formulário
modelo 1.05.
22.13 Desistência da Oferta de Licença
Notificação da desistência da oferta de licença
pelo titular (Art. 64 § 4º).
18.10 Desistência de Caducidade
Notificação de desistência do pedido de
caducidade.
18.11 Decisão Anulada (**)
Anulação da decisão da caducidade por ter
sido indevida.
19.1
21. Extinção de Patente e
Certificado de Adição de
Invenção
22.10 Outros Recursos
Notificação de interposição de recurso ao
Presidente do INPI contra a decisão proferida
pela DIRPA, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
interessado. Poderá ser requerida cópia do
recurso através do formulário modelo 1.05.
22. Outros Referentes a Patentes e
Certificados de Adição de
Invenção
22.2
22.3
Petição Sustada
Sustado o conhecimento da petição para
aguardar providências necessárias ao seu
conhecimento.
22.4
Pedido de Licença Compulsória Para
Exploração de Patente
Notificação de requerimento de licença
compulsória para exploração da patente e
seus certificados, se for o caso, face ao
disposto no Art. 68 da LPI. Desta data corre o
prazo de 60 (sessenta) dias para manifestação
do titular. Ver publicação correspondente na
seção da Diretoria de Transferência de
Tecnologia.
Notificação de Decisão Judicial
Comunicação de decisão judicial referente à
patente.
Publicação Anulada
Anulada a publicação de comunicação de
decisão judicial por ter sido indevida.
Retificação
Retificação da publicação de comunicação de
decisão judicial ter sido efetuada com
incorreção.
Petição Não Conhecida
Não conhecimento da petição apresentada em
virtude do disposto nos Arts. 218 ou 219 da
LPI.
22.5
Exigências Diversas
Formulada exigência para adequação ou
cumprimento de disposições legais no prazo
de 60 (sessenta) dias desta data. Caso a
exigência não tenha sido explicitada no
despacho da RPI, o titular poderá requerer
cópia do parecer através do formulário modelo
1.05.
22.20 Publicação Anulada
Anulada a publicação de qualquer um dos
subitens anteriores por ter sido indevida.
22.21 Despacho Anulado (**)
Anulação do despacho referente a qualquer
um dos subitens anteriores por ter sido
indevido.
22.22 Decisão Anulada (**)
Anulação da decisão referente a qualquer um
dos subitens anteriores por ter sido indevida.
22.23 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
23. Processamento de Pedidos
Segundo Artigos 230 e 231 da
Lei 9279/96
23.1
Notificação de Pedido Depositado
23.1.1 Notificação de Depósito de Pedido Dividido
Notificação de pedido dividido de um pedido
depositado anteriormente. Em relação ao
pedido original, o pedido dividido tem a
mesma data de depósito. O pedido dividido é
considerado como estando na mesma fase
processual do pedido original.
23.2
Exigência
Suspenso andamento do pedido que,para
instrução regular, aguardará o atendimento da
exigência formulada em 90 ( noventa ) dias,
desta data
23.3
Publicação do Pedido para Manifestação de
Terceiros
Publicado o pedido uma vez que já foi
apresentada
a
declaração
de
não
comercialização até a data do depósito. Desta
data corre o prazo de 90 (noventa) dias para
apresentação, por qualquer interessado, de
manifestação quanto ao atendimento ao
disposto no caput do art. 230 da Lei 9279/96.
RPI 2109 de 07/06/2011
23.4
Notificação
Depositante
para
23.5
Anuidade
23.6
Arquivamento
23.7
Denegação do Pedido
23.8
Recurso
23.9
Expedição da Patente
DIRPA - Tabela de Códigos de Despachos 15
Contestação
24.4
Restauração
Notificação quanto à restauração da patente.
24.5
Despacho Anulado (**)
Anulação do despacho referente a qualquer
um dos subitens anteriores por ter sido
indevido.
do
23.10 Publicação Anulada
24.6
Publicação Anulada
Anulação da publicação referente a qualquer
um dos subitens anteriores por ter sido
indevida.
24.7
Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido efetuada
com incorreção.
23.11 Republicação
23.12 Retificação
23.13 Deferimento
Deferido o pedido. Desta data corre o prazo de
60 (sessenta) dias para o pagamento e
comprovação, através do formulário 1.02, da
retribuição para expedição da carta-patente. O
pagamento desta retribuição, poderá ainda ser
efetuado dentro dos 30 (trinta) dias
subsequentes, independente de notificação da
RPI. O não pagamento e sua comprovação
nos prazos acima acarretará o arquivamento
definitivo do pedido.
25. Anotação de Alteração de nome
e/ou sede, de Transferência e de
Limitação ou Ônus de Pedido, Patente
e Certificado de Adição de Invenção.
25.1
23.14 Decisão Anulada
23.15 Expedição Anulada
23.16 Outros
23.17 Ciência Relacionada com o Art. 229 da LPI
O exame técnico concluiu que o pedido atende
aos requisitos estabelecidos pelos artigos 229
a 231 da LPI. O deferimento do mesmo está
condicionado à obtenção da anuência de que
trata o art. 229 da LPI da Lei 9.279/96,
conforme redação dada pela Lei 10.196/2001
23.18 Notificação de Interposição de Nulidade
Administrativa
Notificação ao titular da patente, de
instauração de processo administrativo de
nulidade. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
titular (Art. 52 da LPI). Poderá ser requerida
cópia do processo de nulidade através do
formulário modelo 1.05
24. Anuidade de Patente
24.2
24.3
Exigencia
de
Complementação
de
Anuidade
O
titular
deverá
complementar,
de
acordo com a tabela vigente na data da
complementação,
o
recolhimento
da
anuidade especificada, por meio do formulário
modelo
1.02
acompanhado
dos
comprovantes
dos
pagamentos
correspondentes
ao
cumprimento
da
exigência e a complementação da anuidade.
O não cumprimento no prazo de 60 (sessenta)
dias acarretará a extinção da patente nos
termos do no art. 87 da LPI.
Notificação da extinção da patente para
fins da restauração nos termos do art. 87
da LPI.
Notificação da extinção da patente por falta de
pagamento de anuidade, por pagamento de
anuidade fora do prazo ou por não
cumprimento
de
exigência
de
complementação de pagamento de anuidade.
Desta data corre o prazo de 3 (três) meses
para o titular requerer a restauração da
patente. A restauração deve ser requerida por
meio do formulário modelo 1.02, companhado
dos
comprovantes
dos
pagamentos
correspondentes à restauração e à anuidade
ou sua complementação. Caso não seja
requerida a restauração a patente será
extinta de acordo com o disposto no inciso IV
do art. 78 da LPI.
Transferência Deferida
Notificação do deferimento da transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
25.2
Transferência Indeferida
Notificação do indeferimento da transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
25.3
Transferência em Exigência
Exigência referente ao pedido de transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para cumprimento da
exigência
formulada,
sob
pena
de
indeferimento da transferência.
25.4
25.5
25.6
25.12 Publicação Anulada
Anulada a publicação de qualquer um dos
subitens anteriores por ter sido efetuada com
incorreção.
25.13 Anotação de Limitação ou Ônus
Notificação referente à anotação de limitação
ou
ônus
conforme
indicado
no
complemento
PR. INPI - Presidência
Nulidade Administrativa - Intimação para
Manifestação
Notificação ao titular da patente e ao
requerente da nulidade, da emissão de
parecer do INPI para manifestação. A
manifestação deverá ser apresentada no
prazo de 60(sessenta) dias, desta data após o
que o processo será decidido. O interessado
poderá requerer cópia do parecer através do
formulário DIRPA Modelo 1.05.
Nulidade Administrativa - Decisão
A decisão da nulidade encerra a instância
administrativa.
Recurso - Exigência
Recurso - Exigência - Art. 214 da LPI
Formulada exigência para complementação
das razões oferecidas a título de recurso no
prazo de 60 (sessenta) dias desta data.
Havendo ou não manifestação sobre a
exigência dar-se-á prosseguimento ao exame
do recurso. Caso a exigência não tenha sido
explicitada no despacho da RPI, o interessado
poderá requerer cópia do parecer através do
formulário DIRPA Modelo 1.05.
Recurso - Decisão
A decisão do recurso é final e irrecorrível na
esfera administrativa.
Alteração de Nome Deferida
Notificação do deferimento da alteração de
nome requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
Considerações Finais
Alteração de Nome Indeferida
Notificação do indeferimento da alteração de
nome requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
Alteração de Nome em Exigência
Exigência referente ao pedido de alteração
nome requerida. Desta data corre o prazo
60 (sessenta) dias para cumprimento
exigência
formulada,
sob
pena
indeferimento da alteração.
de
de
da
de
25.7
Alteração de Sede Deferida
Notificação do deferimento da alteração de
Sede requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
25.8
Alteração de Sede Indeferida
Notificação do indeferimento da alteração de
Sede requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
25.9
Alteração de Sede em Exigência
Exigência referente ao pedido de alteração
Sede requerida. Desta data corre o prazo
60 (sessenta) dias para cumprimento
exigência
formulada,
sob
pena
indeferimento da alteração.
de
de
da
de
25.10 Despacho Anulado (**)
Anulação do despacho referente a qualquer
um dos subitens anteriores por ter sido
indevido.
25.11 Republicação
Republicação da publicação de qualquer um
dos subitens anteriores por ter sido indevida.
Solicitação de Cópias:
1 - Os pedidos de fotocópias podem ser
solicitados na sede do INPI/RJ ou nas
delegacias e representações do INPI
constantes da primeira página da RPI.
(*)
Quando a republicação se referir a item de
publicação que envolva o prazo para tomada
de providências, o prazo contar-se-á a partir da
data da republicação.
(**)
A toda publicação que envolva anulação de
ato ou despacho caberá justificativa no
processo adminstrativo.
16
DIRPA - Tabela de Códigos de Despachos
RPI 2109 de 07/06/2011
(62)
Códigos para
Identificação de Dados
Bibliográficos
(INID)
(11)
(21)
(22)
(30)
(43)
(45)
(51)
(54)
(57)
(61)
Número da Patente
Número do Pedido
Data do Depósito
Dados da Prioridade Unionista (data de
depósito, país, número)
Data da Publicação do Pedido
Data da Concessão da Patente/Certificado
de Adição de Invenção
Classificação Internacional
Título
Resumo
Dados do Pedido ou patente principal do qual
o presente é uma adição (número e
(66)
(71)
(72)
(73)
(74)
(81)
(85)
(86)
(87)
data de depósito)
Dados do pedido original do qual o presente é
uma divisão (número e dadta de depósito)
Dados da Prioridade Interna (número e data de
depósito)
Nome do Depositante
Nome do Inventor
Nome do Titular
Nome do Procurador
Países Designados
Data do Início da Fase Nacional
Número, Idioma e Data do Depósito
Internacional
Número, Idioma e Data da Publicação
Internacional
Diretoria de Patentes - DIRPA
Tabela de Códigos de Despachos de Pedidos e
Patentes (incluindo as de MI/DI expedidas na
vigência da LEI 5772/71)
Período de Transição - LEI 5772/71 (CPI)
RPI 2109 de 07/06/2011
11.30
Arquivamento Definitivo – Art. 18 § 1º da
Lei 5772/71
Notificação da retirada definitiva do pedido
de patente uma vez que não foi requerido o
pedido de exame no prazo previsto pelo Art
18 § 1º, tendo o prazo expirado na vigência
da Lei 5772/71.
11.31
Arquivamento Definitivo - Falta de
Cumprimento de Exigência
Notificação do arquivamento definitivo do
pedido uma vez que não houve manifestação
do depositante quanto à exigência formal;
exigência técnica ou exigência referente ao
Art. 20, tendo o prazo de cumprimento
expirado na vigência da Lei 5772/71.
12.1
13.1
15.2
Arquivamento do Pedido de Patente por
Comprovação Intempestiva de Anuidade AN 082/86 item 4.1
Notificação do arquivamento automático do
pedido de patente, ocorrido durante a
vigência
da
Lei
5772/71,
por
intempestividade de comprovação
de
anuidade. Desta data corre o prazo de 60
(sessenta) dias para o depositante requerer a
restauração do andamento do pedido através
do formulário modelo 1.02, com o
recolhimento correspondente à restauração.
15.3
Arquivamento do Pedido de Patente por
Falta de Comprovação e Recolhimento de
Anuidade - AN 082/86 item 4.1
Notificação do arquivamento automático do
pedido de patente, ocorrido durante a
vigência da Lei 5772/71, por falta de
comprovação e recolhimento de anuidade.
Desta data corre o prazo de 60 (sessenta)
dias para o depositante requerer a
restauração do andamento do pedido através
do formulário modelo 1.02, com o
recolhimento correspondente à restauração,
devendo anexar a guia de recolhimento
referente à anuidade devida. No caso de
arquivamento indevido, o depositante deverá,
no prazo acima, apresentar o comprovante
de recolhimento tempestivo, através do
formulário modelo 1.02, isento de retribuição.
Recurso Contra o Deferimento
Notificação de recurso, interposto na vigência
da Lei 5772/71, contra o deferimento do
pedido de patente, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
depositante. Poderá ser requerida cópia do
recurso através do formulário modelo 1.05.
Notificação
para
Pagamento
da
Retribuição Relativa à Expedição da
Carta-Patente dos Pedidos Deferidos na
Vigência da Lei 5772/71
Desta data corre o prazo de 60 (sessenta)
dias para o pagamento e comprovação de
retribuição para expedição da carta-patente.
O não pagamento e sua comprovação no
prazo acima determinado acarretará o
arquivamento definitivo do pedido.
13.2
Publicação Anulada
Anulação da publicação de notificação para
recolhimento por ter sido indevida.
15.1
Arquivamento do Pedido de Patente por
Comprovação
e
Recolhimento
Intempestivo de Anuidade - AN 082/86
item 4.1
Notificação do arquivamento automático do
pedido de patente, ocorrido durante a
vigência
da
Lei
5772/71,
por
intempestividade
de
comprovação
e
recolhimento de anuidade. Desta data corre
o prazo de 60 (sessenta) dias para o
depositante requerer a restauração do
andamento do pedido através do formulário
modelo
1.02,
com
o
recolhimento
correspondente à restauração.
15.3.1
15.4
Aquivamento do pedido de patente de
Modelo ou Desenho Industrial por falta de
recolhimento de anuidade/comprovação –
AN 082/86 item 4.1
Notificação do arquivamento automático do
pedido de patente, ocorrido durante a
vigência da Lei 5772/71, por falta de
recolhimento/comprovação de anuidade.
Desta data corre o prazo de 60 (sessenta)
dias para o depositante requerer a
restauração do andamento do pedido através
do formulário 1.02, com o recolhimento
correspondente à restauração, não sendo
necessário o recolhimento da(s) anuidade(s).
No caso de arquivamento indevido, o
depositante deverá, no prazo acima,
apresentar o comprovante do recolhimento
tempestivo através do formulário modelo
1.02, isento de retribuição.
Arquivamento do Pedido de Patente por
Falta de Comprovação e Recolhimento de
Anuidade e Comprovação e Recolhimento
Intempestivo de Anuidade - AN 082/86
item 4.1
Notificação do arquivamento automático do
pedido de patente, ocorrido durante a
vigência da Lei 5772/71, por falta e por
intempestividade
de
comprovação
e
recolhimento de anuidade. Desta data corre
o prazo de 60 (sessenta) dias para o
depositante requerer a restauração do
andamento do pedido através do formulário
modelo
1.02,
com
o
recolhimento
correspondente à restauração, devendo
anexar a guia de recolhimento referente à
anuidade devida. No caso de arquivamento
indevido, o depositante deverá, no prazo
acima, apresentar o comprovante de
comprovação e recolhimento tempestivo,
através do formulário modelo 1.02, isento de
retribuição.
15.13
Extinção da Garantia de Prioridade
Notificação da extinção da garantia de
prioridade por não ter sido requerido o
privilégio dentro dos prazos previstos no Art
7º da Lei 5772/71.
18.2
Caducidade - Art 50 da Lei 5772/71
Notificação de caducidade automática da
patente por não ter sido efetuada a
comprovação do pagamento da respectiva
anuidade no prazo legal encerrado na
vigência da Lei 5772/71.
MDIC - MINISTÉRIO DO DESENVOLVIMENTO,
INDÚSTRIA E COMÉRCIO EXTERIOR
Recurso - Interposição
Notificação de interposição, na vigência da
Lei 5772/71, de recurso ao Ministro do
Desenvolvimento, Indústria e Comércio
Exterior contra a decisão proferida pelo
Presidente do INPI, objetivando o reexame
da matéria.
Recurso - Decisão
A decisão do recurso, interposto na vigência
da Lei 5772/71, pelo Ministério do
Desenvolvimento, Indústria e Comércio
Exterior encerra a instância administrativa..
DIRETORIA DE PATENTES - DIRPA
Índice Numérico Remissivo de Pedidos, Patentes
(incluindo as de MI/DI expedidas na vigência da
Lei 5772/71) e Certificados de Adição de Invenção
RPI 2109 de 07/06/2011
C1
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
9905473-6
7601306-5
7601543-2
7601902-0
7800486-1
7903370-9
8000062-2
8000177-7
8002384-3
8100060-0
8100450-8
8100562-8
8101681-6
8102614-5
8200900-7
8201301-2
8201460-4
8202148-1
8203390-0
8301175-7
8302149-3
8302149-3
8302352-6
8303139-1
8303306-8
8303396-3
8303473-0
8400108-9
8401914-0
8402294-9
8402543-3
8501805-8
8600917-6
8601926-0
8602746-8
8702129-3
8801454-1
8801784-2
8801929-2
8801996-9
8802074-6
8802081-9
8802106-8
8802125-4
8802138-6
8802745-7
8802756-2
8802941-7
8802969-7
8802990-5
8900274-1
8900350-0
8900395-0
8900428-0
8900576-7
8900578-3
8900612-7
8900620-8
8900628-3
8901967-9
8901968-7
8901981-4
8901987-3
8901991-1
8901994-6
8901998-9
8902003-0
8902006-5
8902166-5
8902167-3
8902169-0
8902172-0
8902179-7
8902213-0
8902214-9
8902216-5
8902217-3
8902218-1
8902219-0
8902220-3
8902221-1
8902222-0
8902223-8
8.11
24.3
25.1
24.3
25.4
9.1
15.7
9.2
12.2
9.2.4
9.1
9.1
9.2.4
9.1
11.4
9.2.4
9.2.4
9.1
6.1
9.1
7.1
15.11
6.1
7.1
9.1
6.1
7.1
25.1
15.7
15.7
15.7
7.1
11.14
11.14
11.14
25.1
15.7
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
127
136
142
136
144
127
134
129
134
131
127
127
131
127
133
131
131
127
125
127
126
134
125
126
127
125
126
142
134
134
134
126
134
134
134
142
134
94
95
95
95
95
96
96
96
96
97
97
97
97
98
98
98
99
99
99
99
100
100
100
100
100
101
101
101
101
101
102
102
102
103
103
103
103
103
104
104
104
104
105
105
105
105
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
MU
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
8902224-6
8902226-2
8902227-0
8902228-9
8902229-7
8902230-0
8902256-4
8902258-0
8902259-9
8902260-2
8902261-0
8902263-7
8902270-0
8902271-8
8902272-6
8902273-4
8902274-2
8902277-7
8902280-7
8902286-6
8902288-2
8902291-2
8902292-0
8902293-9
8902313-7
8902433-8
8902449-4
8902453-2
8902458-3
8902460-5
8902630-6
8902738-8
8902754-0
8902777-9
8902815-5
9001761-7
9001762-5
9001763-3
9001764-1
9001765-0
9001766-8
9001768-4
9001769-2
9001770-6
9001771-4
0000571-1
0001121-5
0001326-9
0001615-2
0001627-6
0001765-5
0002650-6
0004447-4
0004550-0
0004738-4
0005068-7
0005786-0
0005888-2
0006122-0
0006664-8
0007001-7
0008450-6
0008738-6
0008968-0
0009116-2
0009144-8
0009193-6
0009219-3
0009300-9
0009485-4
0009505-2
0009847-7
0009850-7
0009872-8
0010062-5
0010441-8
0010444-2
0010633-0
0011137-6
0011142-2
0011873-7
0011876-1
0011877-0
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
9.2
9.2.4
9.2
9.2
6.1
25.1
9.1
9.2.4
9.1
15.22
9.2.4
6.1
15.22
9.2
9.2.1
11.5
25.3
11.5
9.2
11.2
7.1
11.5
11.5
9.2
9.2
11.5
9.2
25.1
9.1
9.2
25.1
9.2
11.2
9.2
9.2
11.2
9.2
9.2
106
106
106
106
107
107
107
107
107
108
108
108
108
109
109
109
109
109
110
110
110
111
111
111
111
111
112
112
112
112
112
113
113
113
113
123
123
123
123
123
123
123
123
123
123
129
131
130
130
125
143
128
132
128
135
132
125
135
130
131
133
143
133
130
133
126
133
133
130
130
133
130
143
128
130
143
130
133
130
130
133
130
130
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0012071-5
0012424-9
0012572-5
0012620-9
0012654-3
0012762-0
0012917-8
0013228-4
0013256-0
0013308-6
0013493-7
0013500-3
0013607-7
0013636-0
0013996-3
0014213-1
0014391-0
0014486-0
0014561-0
0014916-0
0015031-2
0015163-7
0015549-7
0015736-8
0016126-8
0016304-0
0016510-7
0016529-8
0016621-9
0016697-9
0017198-0
0017216-2
0100199-0
0100554-5
0100909-5
0101207-0
0101208-8
0101346-7
0101434-0
0101870-1
0101926-0
0102556-2
0102823-5
0103388-3
0104364-1
0104785-0
0105475-9
0105869-0
0105888-6
0106110-0
0106124-0
0106430-4
0106518-1
0107799-6
0107930-1
0107943-3
0108024-5
0108216-7
0108217-5
0108337-6
0108631-6
0108657-0
0108697-9
0109200-6
0109424-6
0109524-2
0109730-0
0109731-8
0110271-0
0110474-8
0110479-9
0110481-0
0110531-0
0110676-7
0110706-2
0110721-6
0110734-8
0110748-8
0110759-3
0110858-1
0110919-7
0110941-3
0110944-8
9.2
9.2
9.2
11.5
11.5
25.1
11.5
9.2
11.5
9.2.4
6.6
9.1
11.2
11.5
9.2
11.5
11.5
9.2
7.1
11.5
15.22
11.5
11.5
9.2
9.2
11.5
15.7
9.2.4
9.2
9.2.4
7.1
25.1
15.22
9.1
9.2
9.1
9.1
15.22
15.11
15.22
15.22
15.22
9.2.4
25.1
9.2
25.3
9.2.4
15.10
9.2.4
6.1
9.2.4
9.2
15.11
7.1
11.5
11.5
7.1
7.1
7.1
9.2.4
7.1
6.1
11.5
7.1
9.2.4
11.5
9.2.4
9.2.4
9.2.4
11.5
9.2.4
11.5
15.22
11.5
11.5
9.1
7.1
7.1
11.5
9.1
7.1
9.1
11.2
130
130
130
133
133
143
133
130
133
132
125
128
133
133
130
133
133
130
126
133
135
133
133
130
130
133
134
132
130
133
126
143
135
128
130
128
128
135
134
135
135
135
132
143
130
144
132
134
132
125
132
130
134
126
133
133
126
126
126
132
126
125
133
126
132
133
132
132
132
133
132
133
135
133
133
128
126
126
133
128
126
128
133
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0111071-3
0111158-2
0111239-2
0111277-5
0111435-2
0111656-8
0111747-5
0111767-0
0111823-4
0111826-9
0111830-7
0111939-7
0112007-7
0112276-2
0112372-6
0112394-7
0112470-6
0112637-7
0112821-3
0112871-0
0112914-7
0112942-2
0113196-6
0113250-4
0113377-2
0113435-3
0113619-4
0113651-8
0113703-4
0113727-1
0113825-1
0114055-8
0114097-3
0114254-2
0114440-5
0114576-2
0114812-5
0115224-6
0115224-6
0115431-1
0115516-4
0115588-1
0115621-7
0115740-0
0115822-8
0115825-2
0115964-0
0116094-0
0116124-5
0116130-0
0116204-7
0116242-0
0116531-3
0116588-7
0116848-7
0117325-1
0200002-4
0200149-7
0200515-8
0200529-8
0200751-7
0201114-0
0201578-1
0201666-4
0201838-1
0202747-0
0202967-7
0203256-2
0203404-2
0203800-5
0204030-1
0204450-1
0204558-3
0204709-8
0204734-9
0205304-7
0205311-0
0206049-3
0206371-9
0206371-9
0206658-0
0206661-0
0206898-2
9.1
6.1
6.1
6.1
9.1
6.7
9.2.4
9.2
11.5
7.1
7.1
9.2
9.2
15.22
7.1
7.1
15.22
11.5
9.2
15.11
9.2.4
15.22
9.1
8.11
9.2.4
25.1
11.5
9.2
15.11
6.1
9.2
9.1
7.1
9.1
7.1
6.1
6.1
6.1
15.11
9.2
9.2
9.1
7.1
9.1
9.1
15.22
6.1
6.1
7.1
6.1
6.1
6.1
9.2
6.1
9.1
2.4
9.1
7.1
25.13
25.13
6.1
9.2.4
7.1
15.22
9.2.4
11.2
6.1
7.1
6.1
11.2
9.1
7.1
25.13
6.1
6.1
9.2
9.2
25.7
7.1
15.11
7.1
9.1
9.2.4
128
125
125
125
128
126
132
130
133
126
126
130
130
135
126
126
135
133
130
134
132
135
128
127
132
143
133
131
134
125
131
128
126
128
126
125
125
125
134
131
131
128
126
128
129
135
125
125
126
125
125
125
131
125
129
124
129
127
144
144
125
132
127
135
132
133
125
127
125
133
129
127
145
125
125
131
131
144
127
134
127
129
132
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0206996-2
0207921-6
0208047-8
0208047-8
0208296-9
0208434-1
0208620-4
0208621-2
0208740-5
0208772-3
0209346-4
0209531-9
0209584-0
0210193-9
0210591-8
0212608-7
0213387-3
0213415-2
0213662-7
0213758-5
0215496-0
0215584-2
0215658-0
0215689-0
0215691-1
0215897-3
0300182-2
0300724-3
0301170-4
0301480-0
0303366-0
0303423-2
0303722-3
0304118-2
0304867-5
0305109-9
0305296-6
0305382-2
0305525-6
0305774-7
0305793-3
0306146-9
0306171-0
0306945-1
0307221-5
0307476-5
0308152-4
0308360-8
0308625-9
0308671-2
0308715-8
0308716-6
0308797-2
0309013-2
0309136-8
0309141-4
0309192-9
0309295-0
0309313-1
0309381-6
0309453-7
0309469-3
0309834-6
0310109-6
0310124-0
0311240-3
0311550-0
0311634-4
0311638-7
0311785-5
0311847-9
0313074-6
0313785-6
0313863-1
0314145-4
0314334-1
0314744-4
0314805-0
0315425-4
0315697-4
0316154-4
0316344-0
0316378-4
25.7
7.1
7.1
15.11
9.2
9.1
9.2
9.2
9.2.4
9.2.4
9.2.4
25.1
9.2.4
9.1.1
9.2
9.2
9.2.4
11.2
7.1
9.2.4
9.2.4
8.7
9.1
25.4
9.2.4
8.7
6.7
9.1
15.22
9.1
8.7
9.1
9.1
9.1
9.1
9.1
9.1
9.1
15.11
9.1
9.2.4
9.1
9.2.4
6.1
8.7
6.1
9.2.4
8.7
9.1
9.1
9.1
6.1
9.1
9.1
9.1
6.1
9.1
9.1
6.1
9.1
9.1
6.1
9.1
9.1
9.1
9.1
6.1
9.1
6.1
15.22
9.1
9.1
6.1
6.9
9.2.4
7.2
6.1
6.1
7.1
6.1
7.1
7.1
7.1
144
127
127
134
131
129
131
131
132
132
132
143
132
129
131
131
132
133
127
133
133
127
129
144
133
127
126
127
135
127
127
127
127
127
127
127
127
127
134
127
131
127
131
125
127
125
131
127
127
127
127
125
127
127
127
125
128
128
125
128
128
125
128
128
128
128
125
128
125
135
128
128
125
126
131
127
125
125
126
125
126
126
126
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0316770-4
0316996-0
0317248-1
0317601-0
0317664-9
0317758-0
0318765-9
0401922-9
0402169-0
0405174-2
0406875-0
0407363-0
0407455-6
0407984-1
0408448-9
0410718-7
0501124-8
0501228-7
0501337-2
0501348-8
0502003-4
0506323-0
0508044-4
0518944-6
0520249-3
0600453-9
0600735-0
0602223-5
0602369-0
0602726-1
0602836-5
0603159-5
0603512-4
0603648-1
0603699-6
0603796-8
0605651-2
0605962-7
0606134-6
0608065-0
0612601-4
0612979-0
0613701-6
0614047-5
0614198-6
0615515-4
0615588-0
0615640-1
0616018-2
0616019-0
0616020-4
0616021-2
0616022-0
0616023-9
0616024-7
0616025-5
0616027-1
0616028-0
0616029-8
0616030-1
0616031-0
0616032-8
0616033-6
0616034-4
0616035-2
0616036-0
0616037-9
0616038-7
0616039-5
0616040-9
0616041-7
0616042-5
0616043-3
0616044-1
0616045-0
0616046-8
0616047-6
0616049-2
0616051-4
0616053-0
0616054-9
0616055-7
0616056-5
6.7
6.7
9.2.4
25.3
9.1
7.2
8.8
9.2.4
9.2
9.1
6.7
9.1
25.1
9.1
25.3
9.1
25.1
15.11
6.1
6.1
25.3
11.2
8.8
11.6.
15.22
25.3
15.7
11.14
11.14
11.14
15.7
11.14
15.7
11.14
25.6
25.6
25.1
25.3
25.6
25.6
25.1
25.1
1.3
1.3
1.3
25.7
25.7
25.4
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
126
126
131
143
128
127
127
131
129
128
126
128
142
128
143
128
142
134
125
125
143
133
127
134
135
143
134
134
134
134
134
134
134
134
144
144
142
143
144
144
142
142
23
23
23
144
144
144
23
23
24
24
24
25
25
25
25
25
26
26
26
26
27
27
27
27
28
28
28
28
29
29
29
29
29
30
30
30
30
30
31
31
31
20
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
DIRPA - Índice Numérico Remissivo
0616057-3
0616058-1
0616059-0
0616060-3
0616061-1
0616062-0
0616063-8
0616066-2
0616067-0
0616068-9
0616069-7
0616070-0
0616071-9
0616072-7
0616073-5
0616074-3
0616075-1
0616076-0
0616077-8
0616078-6
0616079-4
0616080-8
0616081-6
0616082-4
0616083-2
0616084-0
0616085-9
0616086-7
0616087-5
0616088-3
0616089-1
0616090-5
0616092-1
0616094-8
0616096-4
0616097-2
0616098-0
0616099-9
0616100-6
0616101-4
0616102-2
0616103-0
0616104-9
0616105-7
0616106-5
0616107-3
0616108-1
0616109-0
0616110-3
0616111-1
0616113-8
0616114-6
0616115-4
0616116-2
0616117-0
0616118-9
0616119-7
0616120-0
0616121-9
0616122-7
0616123-5
0616124-3
0616125-1
0616126-0
0616127-8
0616129-4
0616132-4
0616135-9
0616136-7
0616137-5
0616138-3
0616139-1
0616141-3
0616142-1
0616143-0
0616145-6
0616146-4
0616148-0
0616149-9
0616150-2
0616151-0
0616152-9
0616154-5
0616155-3
0616156-1
0616157-0
0616158-8
0616159-6
0616160-0
0616161-8
0616162-6
0616163-4
0616164-2
0616165-0
0616166-9
0616167-7
0616168-5
0616169-3
0616170-7
0616171-5
0616172-3
0616173-1
0616174-0
0616175-8
0616176-6
0616177-4
0616178-2
0616179-0
0616180-4
0616183-9
0616184-7
0616185-5
0616186-3
0617688-7
0702270-0
0707481-6
0708269-0
0708373-4
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
25.6
1.3.1
1.3
1.3
31
31
32
32
32
32
32
32
33
33
33
33
33
33
33
34
34
34
34
34
34
35
35
35
35
36
36
36
36
36
36
37
37
37
37
38
38
38
38
39
39
39
39
39
40
40
40
40
41
41
41
41
41
42
42
42
42
43
43
43
43
43
44
44
44
44
44
44
44
45
45
45
45
46
46
46
46
46
47
47
47
47
47
48
48
48
48
49
49
49
49
50
50
50
50
51
51
51
51
52
52
52
52
52
53
53
53
53
53
54
54
54
54
55
144
123
55
55
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0708374-2
0708375-0
0708376-9
0708377-7
0708378-5
0708379-3
0708381-5
0708382-3
0708440-4
0708441-2
0708442-0
0708443-9
0708444-7
0708445-5
0708446-3
0708447-1
0708448-0
0708449-8
0708450-1
0708451-0
0708452-8
0708453-6
0708454-4
0708558-3
0708559-1
0708560-5
0708561-3
0708562-1
0708563-0
0708564-8
0708565-6
0708566-4
0708582-6
0708586-9
0708587-7
0708588-5
0708589-3
0708590-7
0708591-5
0708592-3
0708593-1
0708594-0
0708595-8
0708596-6
0708597-4
0708598-2
0708599-0
0708600-8
0708601-6
0708602-4
0708603-2
0708604-0
0708605-9
0708607-5
0708608-3
0708610-5
0708611-3
0708612-1
0708613-0
0708614-8
0708615-6
0708616-4
0708617-2
0708618-0
0708619-9
0708620-2
0708621-0
0708622-9
0708623-7
0708624-5
0708625-3
0708626-1
0708627-0
0708629-6
0708630-0
0708631-8
0708636-9
0708637-7
0708638-5
0708639-3
0708640-7
0708641-5
0708642-3
0708643-1
0708644-0
0708645-8
0708646-6
0708647-4
0708648-2
0708649-0
0708650-4
0708652-0
0708653-9
0708654-7
0708655-5
0708656-3
0708657-1
0708658-0
0708659-8
0708660-1
0708661-0
0708662-8
0708663-6
0708664-4
0708665-2
0708666-0
0708667-9
0708668-7
0708669-5
0708670-9
0708671-7
0708673-3
0708674-1
0708675-0
0708680-6
0708681-4
0708682-2
0708683-0
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
RPI 2109 de 07/06/2011
55
55
55
56
56
56
56
56
57
57
57
57
58
58
58
58
58
58
59
59
59
59
60
60
60
60
61
61
61
61
61
61
62
62
62
62
63
63
63
63
63
63
64
64
64
64
65
65
65
65
66
66
66
66
67
67
67
67
68
68
68
68
68
69
69
69
69
69
70
70
70
70
70
70
71
71
71
71
71
72
72
72
72
73
73
73
73
73
74
74
74
74
75
75
75
75
75
75
76
76
76
76
77
77
77
78
78
78
78
78
78
79
79
79
79
80
80
80
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
0708684-9
0708685-7
0708686-5
0708687-3
0708688-1
0708689-0
0708690-3
0708691-1
0708694-6
0708695-4
0708696-2
0708697-0
0708698-9
0708699-7
0708700-4
0708701-2
0708702-0
0708703-9
0708704-7
0708705-5
0708706-3
0708707-1
0708708-0
0708709-8
0708711-0
0708712-8
0708713-6
0708714-4
0708715-2
0708716-0
0708717-9
0708718-7
0708719-5
0708720-9
0708721-7
0708722-5
0708723-3
0708724-1
0708725-0
0708726-8
0708727-6
0708728-4
0708729-2
0708730-6
0708731-4
0709780-8
0710741-2
0710743-9
0710744-7
0710745-5
0710760-9
0710761-7
0710762-5
0710763-3
0710764-1
0710765-0
0710766-8
0710767-6
0710768-4
0710769-2
0710770-6
0710771-4
0800013-1
0800098-0
0800141-3
0800228-2
0800276-2
0800277-0
0802193-7
0803390-0
0804668-9
0805338-3
0901098-0
0902824-2
0903373-4
0903587-7
0903766-7
0903803-5
0903822-1
0903826-4
0903866-3
0903937-6
0903943-0
0903946-5
0903947-3
0903959-7
0903966-0
0903967-8
0903968-6
0903969-4
0903978-3
0903980-5
0903987-2
0903989-9
0903990-2
0903991-0
0903993-7
0903996-1
0903997-0
0903998-8
0904010-2
0904013-7
0904015-3
0904016-1
0904018-8
0905455-3
0914276-2
1002031-4
1003348-3
1003532-0
1003533-8
1003534-6
1003535-4
1003536-2
1003537-0
1003538-9
1003539-7
1003540-0
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
25.1
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
1.3
3.1
3.1
3.1
3.1
3.1
3.1
15.22
3.7
3.1
25.13
3.1
25.3
25.3
25.3
3.1
3.1
3.1
3.1
25.3
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
3.1
25.3
3.1
3.1
3.2
2.1
2.1
2.7
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
80
81
81
81
81
82
82
82
82
83
83
83
83
84
84
84
85
85
85
85
85
85
86
86
86
86
86
87
87
87
87
87
88
88
88
88
89
89
89
89
89
89
90
90
90
142
90
91
91
91
91
92
92
92
92
93
93
93
93
93
94
94
114
114
114
114
114
115
135
125
115
144
115
143
143
143
116
116
116
116
143
116
117
117
117
117
118
118
118
118
119
119
119
119
120
120
120
120
120
121
121
121
143
121
121
122
123
123
125
123
123
123
123
123
123
123
123
123
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
1003541-9
1003561-3
1003562-1
1003563-0
1003564-8
1003565-6
1003566-4
1003567-2
1003568-0
1003569-9
1003570-2
1003571-0
1003572-9
1003573-7
1003574-5
1003575-3
1003576-1
1003577-0
1003578-8
1003580-0
1003581-8
1003582-6
1003583-4
1003584-2
1003585-0
1003586-9
1003587-7
1003588-5
1003589-3
1003590-7
1003591-5
1003592-3
1003593-1
1003594-0
1003595-8
1003596-6
1003597-4
1003598-2
1003599-0
1003600-8
1003601-6
1003602-4
1003603-2
1003604-0
1003605-9
1003606-7
1003607-5
1003608-3
1003609-1
1003610-5
1003611-3
1003612-1
1003613-0
1003614-8
1003615-6
1003616-4
1003617-2
1003618-0
1003619-9
1003620-2
1003621-0
1003622-9
1003623-7
1003639-3
1003640-7
1003641-5
1003642-3
1003643-1
1003644-0
1003645-8
1003646-6
1003667-9
9001920-2
9003898-3
9102888-4
9104776-5
9105005-7
9105215-7
9204308-9
9300164-9
9301057-5
9400239-8
9400934-1
9402216-0
9501361-0
9508091-0
9509616-7
9601368-0
9602078-4
9603116-6
9603133-6
9603135-2
9603136-0
9603145-0
9603146-8
9603147-6
9603148-4
9603151-4
9603154-9
9603156-5
9603162-0
9603163-8
9603174-3
9603177-8
9603178-6
9603183-2
9603186-7
9603198-0
9603199-9
9603200-6
9603203-0
9603206-5
9603226-0
9603231-6
9603254-5
9603255-3
9603258-8
9603259-6
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
2.1
25.1
25.1
25.1
15.7
25.1
25.1
25.1
24.7
25.1
25.4
24.4
25.1
25.1
25.1
25.1
25.13
25.13
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
123
123
123
123
123
123
123
123
123
123
123
123
123
123
123
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
124
142
142
142
134
142
143
143
142
143
144
142
143
143
143
143
144
144
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
136
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9603272-3
9603274-0
9603275-8
9603277-4
9603322-3
9603323-1
9603329-0
9603333-9
9603348-7
9603367-3
9603378-9
9603379-7
9603381-9
9603387-8
9603403-3
9603406-8
9603418-1
9603419-0
9603427-0
9603437-8
9603441-6
9603446-7
9603447-5
9603452-1
9603453-0
9603474-2
9603491-2
9603492-0
9603494-7
9603499-8
9603510-2
9603517-0
9603524-2
9603525-0
9603543-9
9603549-8
9603550-1
9603552-8
9603558-7
9603562-5
9603587-0
9603601-0
9603608-7
9603613-3
9603620-6
9603621-4
9603622-2
9603634-6
9603635-4
9603645-1
9603647-8
9603652-4
9603656-7
9603676-1
9603776-8
9603859-4
9604009-2
9604010-6
9604012-2
9604019-0
9604020-3
9604032-7
9604035-1
9604042-4
9604074-2
9604087-4
9604089-0
9604091-2
9604108-0
9604111-0
9604113-7
9604136-6
9604142-0
9604153-6
9604155-2
9604157-9
9604167-6
9604186-2
9604187-0
9604189-7
9604215-0
9606042-5
9606541-9
9606548-6
9606559-1
9606561-3
9606563-0
9606573-7
9606575-3
9606593-1
9606613-0
9606629-6
9606632-6
9606883-3
9606893-0
9607053-6
9607063-3
9607156-7
9607297-0
9607323-3
9607566-0
9609505-9
9609544-0
9609557-1
9609591-1
9609679-9
9609681-0
9609725-6
9609745-0
9609746-9
9609754-0
9609808-2
9609810-4
9609814-7
9609819-8
9609824-4
9609825-2
9609827-9
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
25.13
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
136
136
136
136
136
136
136
136
136
136
136
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
137
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
144
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
138
139
139
139
139
139
139
139
139
139
139
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9609828-7
9609833-3
9609835-0
9609843-0
9609848-1
9609854-6
9609864-3
9609877-5
9609885-6
9609887-2
9609889-9
9609895-3
9609897-0
9609899-6
9609900-3
9609901-1
9609906-2
9609909-7
9609922-4
9609928-3
9609948-8
9609955-0
9609960-7
9609965-8
9609970-4
9609978-0
9609980-1
9609991-7
9609994-1
9609996-8
9609997-6
9610006-0
9610009-5
9610017-6
9610018-4
9610032-0
9610035-4
9610043-5
9610046-0
9610055-9
9610056-7
9610063-0
9610064-8
9610076-1
9610091-5
9610097-4
9610100-8
9610111-3
9610130-0
9610141-5
9610145-8
9610170-9
9610171-7
9610174-1
9610181-4
9610189-0
9610191-1
9610204-7
9610210-1
9610216-0
9610217-9
9610221-7
9610228-4
9610231-4
9610233-0
9610237-3
9610238-1
9610245-4
9610247-0
9610253-5
9610254-3
9610255-1
9610256-0
9610257-8
9610270-5
9610273-0
9610279-9
9610292-6
9610295-0
9610299-3
9610300-0
9610301-9
9610302-7
9610304-3
9610309-4
9610310-8
9610321-3
9610323-0
9610328-0
9610341-8
9610351-5
9610358-2
9610360-4
9610365-5
9610369-8
9610374-4
9610391-4
9610397-3
9610411-2
9610414-7
9610419-8
9610427-9
9610431-7
9610432-5
9610446-5
9610450-3
9610455-4
9610459-7
9610460-0
9610462-7
9610463-5
9610464-3
9610467-8
9610468-6
9610471-6
9610472-4
9610473-2
9610533-0
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
139
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
140
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
RPI 2109 de 07/06/2011
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9610548-8
9610564-0
9610568-2
9610578-0
9610598-4
9610608-5
9610609-3
9610615-8
9610657-3
9610678-6
9610696-4
9610701-4
9610713-8
9610724-3
9610725-1
9610769-3
9610811-8
9610826-6
9610907-6
9611060-0
9611068-6
9611135-6
9611256-5
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
141
141
141
141
141
141
141
141
141
141
141
141
141
141
141
142
142
142
142
142
142
142
142
DIRPA - Índice Numérico Remissivo
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9611262-0
9611701-0
9612228-5
9612251-0
9612254-4
9612600-0
9612604-3
9612672-8
9612681-7
9612683-3
9612684-1
9612694-9
9612711-2
9612713-9
9612719-8
9612721-0
9612722-8
9612723-6
9612877-1
9613009-1
9613016-4
9613017-2
9616032-2
24.3
9.2
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
24.3
11.5
9.2
7.1
7.1
142
129
142
142
142
142
142
142
142
142
142
142
142
142
142
142
142
142
142
133
129
126
126
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9616033-0
9702411-2
9702837-1
9704201-3
9704202-1
9705603-0
9706055-0
9708566-9
9709145-6
9711876-1
9715295-1
9715316-8
9715364-8
9715372-9
9715373-7
9801130-8
9801993-7
9803833-8
9804217-3
9804937-2
9805172-5
9806863-6
9806901-2
7.1
24.5
21.6
25.1
25.1
9.2
25.1
6.6
25.4
PR
7.1
6.7
9.2.1
2.4
2.4
12.2
11.2
15.22
7.1
7.1
6.9
11.2
15.11
126
142
136
143
143
129
143
125
144
9
126
126
131
124
124
134
133
135
126
126
126
133
134
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9809351-7
9810297-4
9810782-8
9810913-8
9811232-5
9812219-3
9813257-1
9813293-8
9814787-0
9815047-2
9815122-3
9815548-2
9900604-9
9902245-1
9902623-6
9902767-4
9903081-0
9903162-0
9903257-0
9903330-5
9905951-7
9906091-4
9906410-3
9.2.4
7.1
25.1
25.1
25.1
7.1
7.1
7.1
12.2
25.4
12.2
PR
9.2.4
9.2.4
6.1
9.2
9.2
15.22
9.2
PR
7.1
9.2
25.7
131
126
143
143
143
126
126
126
134
144
134
9
131
131
125
129
129
135
129
9
126
129
144
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
9906740-4
9906755-2
9907053-7
9908654-9
9909252-2
9909659-5
9909844-0
9910382-6
9910396-6
9910465-2
9910955-7
9911077-6
9911300-7
9911553-0
9911649-9
9911909-9
9912735-0
9912979-5
9913268-0
9913589-2
9913640-6
9913641-4
9913920-0
9.2
11.2
25.4
9.2
11.5
9.2
25.4
6.1
7.1
9.2
9.2
25.4
6.1
25.1
25.1
25.1
9.2
16.3
25.7
9.2
9.2
9.2
11.2
129
133
144
129
133
129
144
125
126
129
129
144
125
143
143
143
129
135
144
129
129
129
133
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PI
PP
PP
9914069-1
9914499-9
9914622-3
9915116-2
9915253-3
9915672-5
9915827-2
9915939-2
9915950-3
9915970-8
9916020-0
9916998-3
9917265-8
9917586-0
9917632-7
9917732-3
9917733-1
9917753-6
9917766-8
9917839-7
1100593-9
1100678-1
25.1
25.4
6.1
25.1
25.4
11.2
9.2
PR
9.1
7.1
11.2
9.2
8.11
6.1
9.2
9.1
9.1
9.2.4
6.1
7.1
19.1
19.1
143
144
125
143
144
133
129
9
128
126
133
129
127
125
129
128
128
131
125
126
135
135
21
Diretoria de Patentes - DIRPA
Notificação - Fase Nacional - PCT
Publicação de Pedidos de Patente e de
Certificado de Adição de Invenção
RPI 2109 de 07/06/2011
1. Pedido Internacional PCT/BR Designado ou Eleito
1.3
NOTIFICAÇÃO - FASE NACIONAL - PCT
(21) PI 0613701-6 A2 (22) 29/06/2006
1.3
(30) 01/07/2005 DE 10 2005 031 185.7
(51) A61B 5/103 (2006.01), A61F 2/76 (2006.01)
(54) RECURSO ORTOPÉDICO TÉCNICO, EM PARTICULAR UMA PRÓTESE
PARA UMA EXTREMIDADE
(57) RECURSO ORTOPÉDICO TÉCNICO, EM PARTICULAR UMA PRÓTESE
PARA UMA EXTREMIDADE. A presente invenção refere-se a um meio auxiliar
técnico ortopédico, em particular, a uma prótese para uma extremidade com,
pelo menos, um elemento ajustável para a produção de um alinhamento teórico,
o alinhamento teórico pode ser verificado, sem um equipamento de medição
externo, por meio de uma disposição do detector, que está posicionada e
executada, de tal modo que, uma seção está no alinhamento teórico e, durante
uma posição de carga estática estável, está em um plano de medição isenta de
momento de torção e, no caso de pequenos desvios da posição de carga
estática estável, produz momentos de torção no plano de medição, e apresenta
os indicadores (15, 16; 26, 27, 28) para a indicação de momentos de torção que
surgem no plano de medição em duas direções que estão opostas uma à outra.
(71) Otto Bock Healthcare Ip Gmbh & Co. Kg (DE)
(72) MARTIN PUSCH
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 28/12/2007
(86) PCT DE2006/001129 de 29/06/2006
(87) WO 2007/003169 de 11/01/2007
(21) PI 0614047-5 A2 (22) 26/06/2006
1.3
(30) 28/06/2005 BE 2005/0328
(51) C01F 11/02 (2006.01), C04B 2/06 (2006.01), B01J 20/04 (2006.01), B01D
53/50 (2006.01), B01D 53/68 (2006.01)
(54) COMPOSIÇÃO DE CAL PULVERULENTA, O RESPECTIVO PROCESSO
DE PRODUÇÃO E A RESPECTIVA UTILIZAÇÃO
(57) COMPOSIÇÃO DE CAL PULVERULENTA, O RESPECTIVO PROCESSO
DE PRODUÇÃO E A RESPECTIVA UTILIZAÇÃO. A presente invenção referese a composição de cal pulverulenta, apresentando uma superfície específica
BET igual ou superior a 25 m2/g e um volume poroso total BJH de dessorção ao
nitrogênio igual ou superior a 0,1 cm3/g e compreendendo, além disso, um
metal alcalino. Processo de produção e utilização da composição para a
redução dos gases de fumaça.
(71) S.A. Lhoist Recherche Et Development (BE)
(72) Alain Laudet, Amandine Gambin
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 28/12/2007
(86) PCT EP2006/063542 de 26/06/2006
(87) WO 2007/000433 de 04/01/2007
(21) PI 0614198-6 A2 (22) 31/07/2006
1.3
(30) 01/08/2005 US 11/194810; 01/08/2005 US 11/194811
(51) A23L 2/00 (2006.01)
(54) COMPOSIÇÃO LÍQUIDA
(57) COMPOSIÇÃO LÍQUIDA. São fornecidos tipos específicos de bebidas
baseadas em proteína de baixo pH (tais como tipos baseados em soja e/ou
laticínios), que são apropriadamente suspensas para evitar sedimentação
indesejável de tais constituintes de proteína durante a armazenagem. Tais
bebidas incluem sistema de espessamento compreendendo celulose bacteriana
(BC) revestida com diferentes co-agentes solúveis em água, de modo que o
componente baseado em BC fornece uma estrutura formadora de rede, que
suspende as proteínas alvo e evita qualquer sedimentação apreciável de tais
proteínas. Adicionalmente, este sistema é capaz de melhorar a suspensão das
bebidas de proteína ácida, fortificadas com cálcio insolúvel. As bebidas
abrangidas dentro desta invenção exibem certos beneficios de estabilidade sob
condições típicas de armazenagem e podem, dependendo do pH do sistema
global, incluir aditivos que revestem as proteínas, para evitar, ou pelo menos
retardar, a agregação de tais proteínas constituintes, quando o nível do pH
aproxima-se de seu ponto isoelétrico pertinente.
(71) CP Kelco U.S., Inc. (US)
(72) C. Ronnie Yuan, MICHELLE KAZMIERSKI
(74) Momsen, Leonardos & CIA.
(85) 31/01/2008
(86) PCT US2006/029888 de 31/07/2006
(87) WO 2007/016547 de 08/02/2007
(21) PI 0616018-2 A2 (22) 27/07/2006
1.3
(30) 29/07/2005 US 11/193,291; 29/07/2005 US 11/193,292; 29/07/2005 US
11/193,295; 29/07/2005 US 11/194,075; 29/07/2005 US 11/194,078
(51) G06F 12/14 (2006.01)
(54) SISTEMAS E MÉTODOS DE SEGURANÇA PARA REDES DE
COMPUTADOR
(57) SISTEMAS E METODOS DE SEGURANÇA PARA REDES DE
COMPUTADOR, que consistem em sistemas e métodos de segurança que
proporcionam uma defesa contra vírus conhecidos e desconhecidos, programas
maliciosos, softwares espião, invasores, e softwares indesejados ou
desconhecidos. O sistema pode implementar diretrizes centralizadas que
permitem que um administrador aprove, bloqueie, coloque emquarentena, ou
registre atividades de arquivos, O sistema mantém meta- informações de
arquivos nos hospedeiros e no servidor. Um hospedeiro detecta operações de
arquivos que podem provocar mudanças no conteúdo do arquivo ou no nome
do arquivo, e atualiza as meta-informações do hospedeiro e/ou do servidor
como resultado. As modificações das meta-informações do servidor são
disponibilizadas para os hospedeiros.
(71) Bit9, Inc (US)
(72) Todd F. Brennan, Allen Hillery, John Hanratty
(74) Símbolo Marcas e Patentes Ltda
(85) 29/01/2008
(86) PCT US2006/029714 de 27/07/2006
(87) WO 2007/016478 de 08/02/2007
(21) PI 0616019-0 A2 (22) 21/06/2006
(30) 19/07/2005 US 60/701,001; 29/12/2005 US 11/323,965
(51) G10L 19/00 (2006.01), H04S 3/02 (2006.01)
1.3
24
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(54) CONCEITO PARA A CONEXÃO EM PONTE DA LACUNA ENTRE A
CONEXÃO PARAMÉTRICA DE ÁUDIO MULTICANAIS E A CONEXÃO
SURROUND MATRIZADA MULTICANAIS
(57) CONCEITO PARA A CONEXÂO EM PONTE DA LACUNA ENTRE A
CONEXÃO PARAMÊTRICA DE AUDIO MULTICANAIS E A CONEXÁO
SURROUND MATRIZADA MULTICANAIS. O propósito da invenção é fazer
uma ponte na lacuna entre a conexão paramétrica de áudio multicanais e a
conexão surround matrizada multicanais, melhorando gradualmente o som de
um sinal upmix enquanto aumenta a taxa consumida de bits pelas informações
auxiliares, iniciando de O até as taxas de bits dos métodos paramétricos. Mais
especificamente, provê um método para a escolha flexível de um ponto de
operações em algum lugar entre o surround matrizado (sem informações
auxiliares, qualidade limitada de áudio) e a reconstrução totalmente paramétrica
(necessária taxa completa de informações auxiliares, boa qualidade) Este ponto
de operações pode ser escolhido dinamicamente (isto é, variando no tempo) e
em resposta à taxa admissível de informações auxiliares, como indicado pela
aplicação individual.
(71) Fraunhofer-Gesellschaft Zur Forderung Der Angewandten Forschung E.V
(DE) , Agere Systems INC (US)
(72) Karsten Linzmeier, Johannes Hilpert, Christof Faller, Ralph Sperschneider
(74) Cruzeiro Newmarc Patentes e Marcas Ltda.
(85) 16/01/2008
(86) PCT EP2006/005971 de 21/06/2006
(87) WO 2007/009548 de 25/01/2007
(21) PI 0616020-4 A2 (22) 12/07/2006
1.3
(30) 18/07/2005 FR 0507567
(51) G01S 5/14 (2010.01), G01C 21/16 (2006.01)
(54) PROCEDIMENTO PARA DETERMINAR A POSIÇÃO NO SOLO DE UM
VEÍCULO E DISPOSITIVO EMBARCADO PARA DETERMINAR A POSIÇÃO
NO SOLO DE UM VEÍCULO
(57) PROCEDIMENTO PARA DETERMINAR A POSIÇAO NO SOLO DE UM
VEICULO E DISPOSITIVO EMBARCADO PARA DETERMINAR A POSIÇÃO
NO SOLO DE UM VEÍCULO A invenção refere-se a um dispositivo (1)
compreendendo meios (2) para emitir periodicamente dados de posição, meios
(3) para emitir dados inerciais, meios (4) para determinar a posição do objeto
móvel em cada emissão de dados de posição baseada no mesmo, e meios (5)
para determinar a posição do objeto móvel entre duas emissões sucessivas de
dados de posição, o intervalo de tempo entre duas emissões sucessivas sendo
dividido em faixas de tempo de igual duração separadas por tempos
intermediários, os últimos meios (5) determinando para cada tempo
intermediário atual a posição do objeto móvel, baseado na sua posição no
tempo intermediário precedente e baseado em seu movimento durante a faixa
de tempo delimitada pelos tempos intermediários atual e precedente,
movimento que é calculado por meio dos dados inerciais.
(71) Airbus France (FR)
(72) Fabien Fetzmann, Pierre Coldefy, Thierry Malaval, Stéphane Collins
(74) Antonio Mauricio Pedras Arnaud
(85) 16/01/2008
(86) PCT FR2006/001692 de 12/07/2006
(87) WO 2007/010116 de 25/01/2007
RPI 2109 de 07/06/2011
(21) PI 0616021-2 A2 (22) 13/07/2006
1.3
(30) 22/07/2005 FR 0507801
(51) G01C 23/00 (2006.01)
(54) DISPOSITIVO DE AUXÍLIO À NAVEGAÇÃO NO SOLO DE UMA
AERONAVE EM UM AEROPORTO E AERONAVE
(57) DISPOSITIVO DE AUXÍLIO A NAVEGAÇAO NO SOLO DE UMA
AERONAVE EM UM AEROPORTO E AERONAVE O dispositivo (1) comporta
meios (2) para determinar a posição corrente da aeronave, uma base de dados
carto9ráficos (3) , um sistema de navegação (4), meios (9) para determinar o
rumo corrente da aeronave, e um sistema de exibição (6) que apresenta sobre
uma tela de visualização (8) um mapa pelo menos parcial de aeroporto e, sobre
este último, um símbolo-aeronave que está posicionado na dita posição
corrente e que está orientado segundo o dito rumo corrente.
(71) Airbus France (FR)
(72) Pierre Coldefy, Thierry Malaval, Stéphane Collins, Fabien Fetzmann
(74) Antonio Mauricio Pedras Arnaud
(85) 16/01/2008
(86) PCT FR2006/001712 de 13/07/2006
(87) WO 2007/010120 de 25/01/2007
(21) PI 0616022-0 A2 (22) 17/07/2006
1.3
(30) 27/07/2005 FR 0508008
(51) H04L 29/06 (2006.01), H04B 7/185 (2006.01)
(54) SISTEMA DE TRANSMISSÃO DE DADOS, CONJUNTO DE
COMUNICAÇÃO E AERONAVE
(57) SISTEMA DE TRANSMISSÃO DE DADOS, CONJUNTO DE
COMUNICAÇÃO E AERONAVE Sistema de transmissão de dados para
aeronave que é destinado à transmissão de dados entre a aeronave e um posto
de transmissão situado no exterior da mencionada aeronave. O sistema (1)
compreende um dispositivo de emissão/recepção (3) susceptível de emitir e
receber do exterior da aeronave as mensagens de dados, um dispositivo de
gestão de mensagens (6) compreendendo um meio (8) susceptível de realizar
uma codificação/decodificação do tipo PER das mencionadas mensagens, um
meio de interface (9) susceptível de apresentar a um operador as mensagens
entrantes e permitindo ao operador gerar as mensagens saindo, um dispositivo
de codificação (13) que compreende uma função de codificação do meio de
codificação/decodificação (8), e um dispositivo de gravação (14) registrando,
em um suporte de gravação (16) , toda mensagem de dados entrante ou que
sai, que é relativa a uma comunicação interna/externa, que transita pelo
dispositivo de gestão de mensagens (6) e que é codificada.
(71) Airbus France (FR)
(72) Laurent Galy, Dominique Baron
(74) Antonio Mauricio Pedras Arnaud
(85) 16/01/2008
(86) PCT FR2006/001739 de 17/07/2006
(87) WO 2007/012727 de 01/02/2007
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 25
uma superfície interna inferior da célula principal enquanto é arranjado na
câmara de combustão primária, sendo que o segundo contato elétrico
corresponde ao primeiro contato elétrico, e uma válvula de ignição de chama
transversal acoplada à célula principal pela parte de extensão em um estado
curvo da parte de extensão, em que a válvula de ignição de chama transversal
tem um furo de ignição principal e furos de ignição auxiliares para guiar as
chamas da câmara de combustão primária para o interior de um cilindro.
(71) In Tae Johng (KR)
(72) In Tae Johng
(74) David do Nascimento Advogados Associados
(85) 28/01/2008
(86) PCT KR2006/002940 de 26/07/2006
(87) WO 2007/013765 de 01/02/2007
(21) PI 0616023-9 A2 (22) 17/07/2006
1.3
(30) 20/07/2005 US 60/701,049
(51) C07C 269/04 (2006.01), C07C 263/04 (2006.01)
(54) PROCESSO PARA A PREPARAÇÃO DE CARBAMATOS AROMÁTICOS
E PROCESSO PARA A FORMAÇÃO DE UM ISOCIANATO
(57) PROCESSO PARA A PREPARAÇAO DE CARBAMATOS AROMÁTICOS
E PROCESSO PARA A FORMAÇAO DE UM ISOCIANATO Processo para a
preparação de carbamatos aromáticos, compreendendo contatar um ou mais
carbonatos orgânicos com uma amina aromática ou uréia na presença de um
catalisador e recuperar o produto carbamato aromático resultante, caracterizado
pelo fato de o catalisador ser um catalisador heterogêneo compreendendo um
composto de metal dos Grupos 12-15, suportado por um substrato.
(71) Dow Global Technologies, Inc. (US)
(72) David C. Molzahn
(74) Antonio Mauricio Pedras Arnaud
(85) 16/01/2008
(86) PCT US2006/027825 de 17/07/2006
(87) WO 2007/015852 de 08/02/2007
(21) PI 0616024-7 A2 (22) 26/07/2006
1.3
(30) 28/07/2005 US 11/193,230
(51) B42D 15/10 (2006.01), B41M 3/10 (2006.01)
(54) MÉTODO PARA A CRIAÇÃO DE UMA CARACTERÍSTICA DE IMAGEM
DO TIPO MARCA D' ÁGUA EM UM CARTÃO DE PLÁSTICO E
CARACTERÍSTICA EM UM CARTÃO DE PLÁSTICO
(57) MÉTODO PARA A CRIAÇÃO DE UMA CARACTERÍSTICA DE IMAGEM
DO TIPO MARCA D'AGUA EM UM CARTÃO DE PLÁSTICO E
CARACTERÍSTICA EM UM CARTÃO DE PLASTICO Uma característica de
imagem anti-falsificação (104) para os cartões de plástico laminados utilizados
para a identificação e a transaçao, a qual tem a aparência de uma marca
d'água. A presente invenção utiliza uma camada microporosa de polietileno
carregado com sílica (101) que pode ser deformada (isto é, estampada através
de gravação em alto-relevo ou em baixo-relevo) criando uma imagem (105) que
aparece como uma marca d'água através de camadassubseqúentemente
laminadas (102, 103) . A camada microporosa de polietileno carregado com
sílica (tal como poliolefina) (101) pode ser gravada em alto-relevo ou em baixorelevo para criar uma imagem, e laminada subseqúentemente sob parâmetros
definidos sem estragar a imagem (105) na camada de poliolefina (101). Além
disso, a imagem pode ser criada com uma folha delgada holográfica estampada
por um processo de estampagem a frio ou a quente.
(71) Document Security Systems, Inc (US)
(72) Michael Patrick Caulley, Phieu Luong
(74) David do Nascimento Advogados Associados
(85) 28/01/2008
(86) PCT US2006/028983 de 26/07/2006
(87) WO 2007/016148 de 08/02/2007
(21) PI 0616025-5 A2 (22) 26/07/2006
1.3
(30) 26/07/2005 KR 10-2005-0067961
(51) H01T 13/00 (2006.01), H01T 13/20 (2006.01), H01T 13/46 (2006.01)
(54) VELA DE IGNIÇÃO
(57) VELA DE IGNIÇÃO Trata-se de uma vela de ignição que inclui uma célula
principal oca que tem uma parte de extensão flexível e uma câmara de
combustão primária, um isolador montado na célula principal, para isolar uma
haste terminal encaixada centralmente na célula principal, um eletrodo central
que tem um primeiro contato elétrico arranjado na câmara de combustão
primária, sendo que o eletrodo central se estende para baixo da haste terminal
enquanto é circundado pelo isolador, um segundo contato elétrico disposto em
(21) PI 0616027-1 A2 (22) 01/09/2006
1.3
(30) 14/09/2005 US 11/226,636
(51) C08L 69/00 (2006.01), C08L 25/12 (2006.01), C08L 51/00 (2006.01), C08K
3/34 (2006.01), C08K 5/49 (2006.01)
(54) COMPOSIÇÃO TERMOPLÁSTICA DE MOLDAGEM E ARTIGOS
TERMOFORMADOS DA MESMA
(57) COMPOSIÇÃO TERMOPLÁSTICA DE MOLDAGEM E ARTIGOS
TERMOFORMADOS DA MESMA. A presente invenção refere-se a uma
composição termoplástica de moldagem adequada para preparar artigos por
meio de termoformação. A composição de moldagem que compreende: A)
poli(éster)carbonato aromático ramificado, B) polímero de enxerto, C) um
(co)polímero de vinila opcional e ou tereftalato de polialquileno, D) pelo menos
um composto de fósforo retardador de chama selecionado do grupo que
consiste em ésteres de fósforo e fosfônico mono e oligoméricos, fosfonato
aminas e fosfazenos e E) talco, caracterizado pelo fato de que seu módulo de
flexão sob temperatura ambiente é pelo menos 3.000 N/mm2 e que sua energia
por queda de dardo sob ruptura, a -30ºC, é pelo menos 40,0 J. Lâminas
extrusadas da composição são adequadas para produzir artigos úteis por meio
de termoformação.
(71) Bayer Materialscience AG (DE)
(72) ECKHARD WENZ, PIERRE MOULINIÉ, THOMAS ECKEL, VERA
BUCHHOLZ, DIETER WITTMANN, BRUCE L. HAGER, FRED J. ZAGANIACZ
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/008546 de 01/09/2006
(87) WO 2007/031201 de 22/03/2007
(21) PI 0616028-0 A2 (22) 13/09/2006
1.3
(30) 17/09/2005 DE 10 2005 044 534.9
(51) F17C 13/08 (2006.01), B64G 1/40 (2006.01)
(54) TANQUE DE PROPELENTE PARA LÍQUIDOS CRIOGÊNICOS
(57) TANQUE DE PROPELENTE PARA LÍQUIDOS CRIOGÊNICOS. A
presente invenção refere-se a um tanque de propelente, que serve
principalmente para armazenagem de combustíveis criogênicos, por exemplo
de naves espaciais e que é operado com um gás propelente servindo como
meio transportador, a separação do propelente do gás propelente é feita em um
dispositivo de retirada de propelente por meio de crivo e com aproveitamento de
forças hidrostáticas e forças capilares. O dispositivo de retirada possui a forma
de um reservatório recarregável, que é disposto nas proximidades do fundo do
tanque fora da cuba do tanque na região de fundo do tanque de propelente e
está unido com o interior do tanque de pro- pelente através de um número de
furos. O próprio dispositivo de retirada consiste em uma caixa de parede dupla
e é adicionalmente e termicamente isolado. Chapas capilares e reforços
adicionais estão dispostos em forma de L no reservatório. Além disso, para
impedir amplamente a penetração de gás proveniente do conduto de propelente
está disposto um crivo plissado, cilíndrico, na extremidade do conduto de
propelente.
(71) ASTRIUM GMBH (DE)
(72) Kei Philipp Behruzi, Mark Michaelis, Gaston Netter, Andreas Rittweger
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT DE2006/001605 de 13/09/2006
26
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(87) WO 2007/031064 de 22/03/2007
(21) PI 0616029-8 A2 (22) 05/09/2006
1.3
(30) 16/09/2005 US 60/717985; 08/08/2006 US 11/500862
(51) C08J 3/20 (2006.01), C08J 3/205 (2006.01)
(54) MÉTODO PARA A ADIÇÃO DE UM ADITIVO EM UMA MASSA FUNDIDA
DE POLÍMERO
(57) METODO PARA A ADIÇÃO DE UM ADITIVO EM UMA MASSA FUNDIDA
DE POLÍMERO Método para adicionar um aditivo em uma massa fundida de
polímero, de preferência, uma massa fundida de polímero de poliéster como
polietileno terefialato (PET), que é composto de: a. descarga de uma massa
fundida de polímero de um reator para formar uma corrente de massa fundida
de polímero descarregada, e b. solidificar a referida corrente de massa fundida
de polímero descarregada, e e. antes da solidificação, alimentar uma porção da
corrente de massa fundida de polímero descarregada para uma corrente de
escoamento para formar uma massa fundida de polímero de corrente de
escoamento , e d. alimentar um aditivo na referida massa fundida de polímero
de corrente de escoamento para formar uma corrente de escoamento contendo
um aditivo, e e. alimentar a corrente de escoamento contendo um aditivo para
um local a montante do local de alimentação da formação da referida corrente
de escoamento.
(71) EASTMAN CHEMICAL COMPANY (US)
(72) Bruce Roger Debruin, Kenrick Lyle Venett
(74) Momsen, Leonardos & CIA.
(85) 14/03/2008
(86) PCT US2006/034524 de 05/09/2006
(87) WO 2007/035249 de 29/03/2007
(21) PI 0616030-1 A2 (22) 14/09/2006
1.3
(30) 15/09/2005 US 11/229011
(51) B01D 53/50 (2006.01)
(54) MÉTODO DE REMOÇÃO DE SO3 DE UMA CORRENTE DE GÁS DE
COMBUSTÃO
(57) METODO DE REMOÇÃO DE SO3 DE UMA CORRENTE DE GÁS DE
COMBUSTÃO A invenção refere-se a um método de remoção de SO3 de uma
corrente de gás de combustão que inclui o fornecimento de um composto de
reação selecionado do grupo que consiste de carbonato de sódio, bicarbonato
de sódio, sesquicarbonato de sódio, e misturas destes. O composto de reação é
injetado na corrente de gás de combustão. A temperatura do gás de combustão
é entre 260 e 454,4ºC. O composto de reação é mantido em contato com o gás
de combustão por um tempo suficiente para reagir uma porção do composto de
reação com uma porção do SO3 para reduzir a concentração do SO3 na
corrente de gás de combustão.
(71) SOLVAY CHEMICALS INC. (US)
(72) Jonh Maziuk Jr.
(74) Momsen, Leonardos & CIA.
(85) 14/03/2008
(86) PCT EP2006/066358 de 14/09/2006
(87) WO 2007/031551 de 22/03/2007
(21) PI 0616031-0 A2 (22) 13/09/2006
1.3
(30) 14/09/2005 US 60/714,526; 10/05/2006 US 60/799,605
(51) C07D 471/04 (2006.01), A61K 31/519 (2006.01), A61P 35/00 (2006.01)
(54) 5-OXO-5,8-DIIDRO-PIRIDO-PIRIMIDINAS COMO INIBIDORES DE C-FMS
CINASE
(57) 5-OXO-5,8-DIIDRO-PIRIDO-PIRIMIDlNAS COMO INIBIDORES DE C-FMS
CINASE. A presente invenção refere-se à necessidade corrente de inibidores
seletivos e potentes de proteína tirosina cinase, pela provisão de inibidores
potentes de c-fms cinase.
(71) JANSSEN PHARMACEUTICA N.V. (BE)
(72) MARK R. PLAYER, HUI HUANG, HUAPING HU, RENEE DESJARLAIS
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT US2006/035421 de 13/09/2006
(87) WO 2007/033137 de 22/03/2007
(21) PI 0616032-8 A2 (22) 14/09/2006
1.3
(30) 15/09/2005 FR 0509425
(51) E05B 17/04 (2006.01), E05B 17/20 (2006.01), E05B 17/00 (2006.01)
(54) DISPOSITIVO DE ACIONAMENTO PARA ATUAR UM TRINCO POR
MEIO DE UMA FECHADURA; SISTEMA DE FECHAMENTO QUE INCLUI UMA
FECHADURA E UM TRINCO; E VEÍCULO A MOTOR
(57) DISPOSITIVO DE ACIONAMENTO PARA ATUAR UM TRINCO POR
MEIO DE UMA FECHADURA; SISTEMA DE FECHAMENTO QUE INCLUI UMA
FECHADURA E UM TRINCO; E VEÍCULO A MOTOR. Trata-se de um
dispositivo de acionamento (30) para atuar um trinco por meio de uma
fechadura, em particular, para um sistema de porta de veículo a motor, que
inclui um elemento de acoplamento (40) cujas extremidades são adaptadas,
respectivamente, para serem acopladas de forma rotativa com uma parte da
fechadura montada de forma axialmente móvel em rotação. A invenção se
caracteriza pelo fato de o dispositivo de acionamento (30) compreender, por
toda a extensão do corpo do elemento de acoplamento, pelo menos um cilindro
plástico rígido fixado ao corpo do elemento de acoplamento, e pelo fato de o(s)
cilindro(s) ser(em) separado(s) do corpo do elemento de acoplamento e pelo
fato de gírar(em) livremente quando se exerce nele(s) um torque, cujo grau é,
estritamente, menor que o torque necessário para interromper o trem de
acionamento do movimento rotativo entre a fechadura e o elemento de
acoplamento.
(71) VALEO SECURITE HABITACLE (FR)
(72) FABRICE GIACOMIN
(74) Trench, Rossi e Watanabe Advogados
(85) 14/03/2008
(86) PCT EP2006/066351 de 14/09/2006
(87) WO 2007/031549 de 22/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616033-6 A2 (22) 06/09/2006
1.3
(30) 15/09/2005 US 11/227528
(51) G06F 17/00 (2006.01), G06F 15/00 (2006.01)
(54) CONTAGEM DE MÁQUINA SEGURA
(57) CONTAGEM DE MÁQUINA SEGURA São descritos um método e mídia
legível por computador para dissuadir pirataria de software em um ambiente de
licença em volume. Uma mensagem de desvio do sistema de ati- vação é
gerada e transmitida. Informação contida na mensagem de desvio do sistema
de ativação é comparada com uma lista de identificadores de máquina. Uma
mensagem de serviço de ligação contém uma contagem de identificadores de
máquina na lista. Uma vez que a contagem alcança um limite pré-determinado,
o desvio do sistema de ativação do software po- de ocorrer.
(71) MICROSOFT CORPORATION (US)
(72) CAGLAR GUNYAKTI, RONALD W. MILLER, XIAOXI (MICHAEL) TAN
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/034631 de 06/09/2006
(87) WO 2007/035258 de 29/03/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 27
(21) PI 0616035-2 A2 (22) 14/09/2006
1.3
(30) 14/09/2005 US 60/717,109
(51) G06F 15/16 (2006.01)
(54) SISTEMA DE SUPRIMENTO DE COR EM MENSAGEM MULTIMÍDIA
PARA FORNECER UMA OU MAIS CORES PARA MENSAGEM MULTIMÍDIA,
MÉTODO PARA FORNECER UMA OU MAIS CORES PARA MENSAGEM
MULTIMÍDIA E MEIO DE LEITURA POR COMPUTADOR PARA ARMAZENAR
PROGRAMA DE COMPUTADOR
(57) SISTEMA DE SUPRIMENTO DE COR EM MENSAGEM MULTIMÍDIA
PARA FORNECER UMA OU MAIS CORES PARA MENSAGEM MULTIMIDIA,
METODO PARA FORNECER UMA OU MAIS CORES PARA MENSAGEM
MtJLTIMIDIA E MEIO DE LEITURA POR COMPUTADOR PARA ARMAZENAR
PROGRAMA DE COMPUTADOR A presente invenção refere-se a um sistema
e a um método para fornecer uma ou mais cores para uma mensagem
multimídia. O sistema compreende uma base de dados do assinante, um
módulo de seleção de cor, um módulo de correlação de cor, e um módulo de
envio, O método compreende armazenar os detalhes da assinatura do
remetente, selecionar uma ou mais cores assinadas pelo remetente,
relacionando uma ou mais cores com a mensagem multimídia e enviar a
mensagem multimídia para pelo menos um receptor.
(71) ROAMWARE, INC. (US)
(72) YUE JUN JIANG
(74) Claudia Christina Schulz
(85) 14/03/2008
(86) PCT US2006/035866 de 14/09/2006
(87) WO 2007/033332 de 22/03/2007
(21) PI 0616034-4 A2 (22) 13/09/2006
1.3
(30) 14/09/2005 US 11/226.043
(51) H04N 7/24 (2011.01)
(54) DECODIFICADOR DE SUBAMOSTRAGEM DE MUDANÇA DE
RESOLUÇÃO ARBITRÁRIA
(57) DECODIFICADOR DE SUBAMOSTRAGEM DE MUDANÇA DE
RESOLUÇAO ARBITRÁRIA A decodificação de subamostragem de mudança
de resolução arbitrária é descrita. Em um aspecto, um fluxo de bits codificado é
recebido. O fluxo de bits codificado é reduzido em um laço de decodificação no
domínio DCT para gerar dados reduzidos.
(71) MICROSOFT CORPORATION (US)
(72) GUOBIN SHEN, WANYONG CAO, YUWEN HE, SHIPENG LI
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/035939 de 13/09/2006
(87) WO 2007/033346 de 22/03/2007
(21) PI 0616036-0 A2 (22) 15/09/2006
1.3
(30) 15/09/2005 US 60/717.299
(51) H04M 11/04 (2006.01), G08B 25/08 (2006.01)
(54) MÓDULO DE INTERFACE DE COMUNICAÇÃO DE LINHA TELEFÔNICA
E SISTEMA DE SEGURANÇA
(57) MÓDULO DE INTERFACE DE COMUNICAÇAO DE LINHA TELEFÓNICA
E SISTEMA DE SEGURANÇA É descrito um módulo de interface de
comunicação de linha telefônica (TLCI) que faz interface de um painel de
segurança com uma linha telefônica de uma rede telefônica e compreende
optoacopladores de recepção, transmissão e de controle de gancho. O
optoacoplador de recepção tem lados de entrada e de saída de recepção. O
lado de entrada de recep- ção recebe um sinal na linha telefônica proveniente
28
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
da rede telefônica e o lado de saida de recepção conduz o sinal até o painel de
segurança. O optoacoplador de transmissão tem lados de entrada e de saida de
transmissão. O lado de entrada de transmissão recebe sinais de transmissão
provenientes do painel de segurança e o lado de saída de transmissão conduz
o sinal de transmissão até a linha telefônica da rede telefônica. O lado de saida
de transmissão é unido em paralelo com o lado de entrada de recepção do
optoacoplador de recepção. O optoacoplador de controle de gancho tem lados
de entrada e saída de gancho. O lado de entrada de gancho recebe um sinal de
gancho proveniente do painel de segurança. O lado de saida de gancho tem
linhas de entrada e saída de gancho. A linha de saída de gancho aciona um
comutador de gancho para conduzir o sinal de gancho até a linha telefôni- ca da
rede telefônica. O lado de saida de gancho é unido em série com o lado de
entrada de recepção do optoacoplador de recepção.
(71) Tyco Safety Products Canada Ltd (CA)
(72) REINHART PILDNER
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT CA2006/001524 de 15/09/2006
(87) WO 2007/030945 de 22/03/2007
(21) PI 0616037-9 A2 (22) 21/08/2006
1.3
(30) 14/09/2005 US 11/226.760
(51) C08L 101/10 (2006.01), C09K 3/10 (2006.01), C08L 75/04 (2006.01), C08L
71/02 (2006.01), C08G 18/10 (2006.01), C09D 101/10 (2006.01), C09J 101/10
(2006.01), C08G 18/71 (2006.01), C08K 5/053 (2006.01)
(54) POLÍMERO SILILADO CURÁVEL POR UMIDADE CONTENDO POLIÓIS
LIVRES PARA APLICAÇÃO EM REVESTIMENTO, ADESIVO E SELANTE
(57) POLÍMERO SILILADO CURÁVEL POR UMIDADE CONTENDO POLIÓIS
LIVRES PARA APLICAÇÃO EM REVESTIMENTO, ADESIVO E SELANTE A
presente invenção refere-se a polímeros sililados curáveis por umidade tendo
grupos hidroxila não reagidos ou livres antes da cura, com proriedades físicas
melhoradas, menor viscosidade e custo inferior, adequados para preparar
revestimentos, adesivos e selantes.
(71) MOMENTIVE PERFORMANCE MATERIALS INC. (US)
(72) YURUN YANG, SHEN MIN, MISTY HUANG
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/032434 de 21/08/2006
(87) WO 2007/037833 de 05/04/2007
(21) PI 0616038-7 A2 (22) 14/09/2006
1.3
(30) 14/09/2005 US 60/717.109
(51) H04Q 7/20 (2009.01), H04L 12/58 (2006.01), H04M 1/663 (2006.01)
(54) SISTEMA PARA ENTREGAR MENSAGEM MULTIMÍDIA A PARTIR DE
REMETENTE DA MENSAGEM E SISTEMA DE ENTRELAÇAMENTO DE
MENSAGEM MULTIMÍDIA
(57) SISTEMA PARA ENTREGAR MENSAGEM MULTIMÍDIA A PARTIR DE
REMETENTE DA MENSAGEM E SISTEMA DE ENTRELAÇAMENTO DE
MENSAGEM MULTIMÍDIA A presente invenção refere-se a um sistema para
entregar uma mensagem multimídia a partir de um remetente da em uma rede
de operadora do remetente de um sistema de serviço de mensagem curta de
vídeo/voz (VVSS) para um receptor de mensagem na rede da operadora de um
receptor. O sistema compreende um hub de serviços adequado para rotear a
mensagem multimídia, o hub de serviços compreendendo uma ou mais de uma
primeira interface com um remetente na rede de operadora VVSS do remetente,
uma segunda interface com um segundo WSS na rede de operadora do
receptor, uma terceira interface com um WSS de um terceiro em uma rede de
operadora VVSS de um terceiro, em que a rede de operadora de um terceiro
está em comunicação com a rede de operadora do receptor, e uma quarta
interface com outro hub de serviços. Ainda, o hub de serviços se comunica com
um VVSS do remetente e com uma operadora do receptor. A operadora do
receptor pode ser uma operadora de WSS do receptor ou uma operadora de
não-WSS do receptor.
(71) ROAMWARE, INC. (US)
(72) YUE JUN JIANG
(74) Claudia Christina Schulz
(85) 14/03/2008
(86) PCT US2006/035843 de 14/09/2006
(87) WO 2007/033323 de 22/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616039-5 A2 (22) 02/09/2006
1.3
(30) 16/09/2005 JP 2005-269562; 04/07/2006 JP 2006-184101
(51) A01N 43/66 (2006.01), A01N 43/54 (2006.01), C07D 251/16 (2006.01),
C07D 239/52 (2006.01), A01P 13/00 (2006.01)
(54) USO DE SULFONANILIDAS COMO HERBICIDA, SULFONANILIDAS,
PROCESSO PARA A SUA PREPARAÇÃO E PARA COMBATER ERVAS
DANINHAS, BEM COMO COMPOSIÇÃO HERBICIDA E PROCESSO PARA
SUA PREPARAÇÃO
(57) USO DE SULFONANILIDAS COMO HERBICIDA, SULFONANILIDAS,
PROCESSO PARA A SUA PREPARAÇÃO E PARA COMBATER ERVAS
DANINHAS, BEM COMO COMPOSIÇÃO HERBICIDA E PROCESSO PARA
SUA PREPARAÇÃO. A presente invenção refere-se a composições herbicidas
compreendendo sulfonanilidas da fórmula (I) em que R1 representa hidrogênio,
flúor, cloro, C1-4 alquila, C1-4 alcóxi, C3- 6 cicloalquil-C1-4 alquilóxi ou C1-4
haloalcóxi, R2representa hidrogênio, flúor ou cloro, R3representa hidrogênio ou
flúor, R4 representa hidrogênio ou C1- 4 alquila que pode ser C1-4 alcóxi
opcionalmente substituído, C3-6 alquenila ou C3-6 alquinila, R5 representa
hidrogênio, R6 representa hidróxi, flúor ou cloro, ou e R6 podem formar, junto
com o carbono ao qual eles estão ligados, C=O, e X representa CH ou N,
contanto que os casos a seguir sejam excluídos: (i) R1 representa hidrogênio,
flúor ou cloro, R2 representa hidrogênio, R3 representa hidrogênio, R4
representa hidrogênio, R5 representa hidrogênio, e R6 representa hidróxi, (ii) R1
representa hidrogênio, flúor ou cloro, R2 representa hidrogênio, R3 representa
hidrogênio, R4 representa hidrogênio, e R5 e R6 formam C=0 junto com o
carbono ao qual eles estão ligados,(iii) R1 representa C1-4 alquila, R2 representa
hidrogênio, R3 representa hidrogênio, R4 representa hidrogênio, R5 representa
hidrogênio, R6 representa hidróxi, e X representa CH, ou (iv) R1 representa C1-4
alquila, R2 representa hidrogênio, R3 re- presenta hidrogênio, R4 representa
hidrogênio, R5 e R6 formam C=0 junto com o carbono ao qual eles estão
ligados, e X representa CH, e compostos novos sendo abrangidos pela fórmula
(I).
(71) BAYER CROPSCIENCE AG (DE)
(72) Koichi Araki, Yoshitaka Sato, Takuya Gomibichi, Keiji Endo, Shinichi
Shirakura, Shin Nakamura, Christopher Rosinger, Dieter Feucht
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/008591 de 02/09/2006
(87) WO 2007/031208 de 22/03/2007
(21) PI 0616040-9 A2 (22) 08/09/2006
1.3
(30) 21/09/2005 EP 05 108716.1
(51) C07D 207/48 (2006.01), A61K 31/40 (2006.01)
(54) CLORIDRATO DE SULFONILPIRRÓL COMO INIBIDOR DE HISTONA
DESACETILASES
(57) CLORIDRATO DE SULFONILPIRRÓL COMO INIBIDOR DE HISTONA
DESACETILASES. Compostos de uma certa fórmula l, em que R1, R2, R3, R4,
R5, R6 e R7 têm os significados indicados na descrição, bem como sais destes
são novos inibidores e HDAC eficazes. Em maiores detalhes, esta invenção
refere-se a sais do composto selecionado dentre (E)-(E)-N-hidróxi-3(1 -[4- (([2(1H-indol-2il)etil]-metil-amino)-metil)-benzeno sulfonil]-1H-pirrol-3-iI)- acrilamida;
(E)-3-[1-(4-dimetilaminometil-benzeno
sulfonil)-1H-pirrol-3-iI]-Nhidróxiacrilamida, e (E)-N-hidróxi-3-[1 -(5-piridina-2-il-tiofeno-2-sulfonil)-1 H- pirrol-3-iI]-
RPI 2109 de 07/06/2011
acrilamida com ácido clorídrico, seus hidratos e formas cristalinas destes sais e
hidratos e formas cristalinas destes sais e hidratos.
(71) NYCOMED GMBH (DE)
(72) Thomas Maier, Thomas Beckers, Rolf-Peter Hummel, Thomas Bär, Martin
Feth, Matthias Müller
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/066189 de 08/09/2006
(87) WO 2007/039403 de 12/04/2007
(21) PI 0616041-7 A2 (22) 23/08/2006
1.3
(30) 16/09/2005 US 60/717,946
(51) A61K 47/48 (2006.01)
(54) COMPOSIÇÕES E MÉTODOS PARA O TRANSPORTE INTRA-OCULAR
DE AGENTES TERAPÊUTICOS
(57) COMPOSIÇÕES E MÉTODOS PARA O TRANSPORTE INTRAOCULAR
DE AGENTES TERAPEUTICOS. Agentes terapêuticos alvejados para
transportador de membrana e métodos de preparação e uso dos mesmos.
(71) ALLERGAN, INC (US)
(72) Patrick M. Hughes, Joan-En Chang-Lin, Orest Olejnik
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT US2006/032765 de 23/08/2006
(87) WO 2007/037849 de 05/04/2007
(21) PI 0616042-5 A2 (22) 18/07/2006
1.3
(30) 16/09/2005 US 228,770; 27/06/2006 US 475,484
(51) A61K 8/02 (2006.01), A61K 8/34 (2006.01), A61K 8/41 (2006.01), A61K
8/46 (2006.01), A61Q 5/02 (2006.01)
(54) XAMPU CONTENDO UMA REDE DE GEL
(57) XAMPU CONTENDO UMA REDE DE GEL As composições de xampu
compreendem (a) de cerca de 5 % a cerca de 50 % de um ou mais tensoativos
detersivos, em peso da composição de xampu, (b) uma fase de rede de gel
dispersa compreendendo, em peso da composição de xampu, (i) pelo menos
cerca de 0,05 % de um ou mais álcoois graxos, (ii) pelo menos cerca de 0,01 %
de um ou mais tensoativos secundários, e (iii) água, e (c) pelo menos cerca de
20 % de um veículo aquoso, em peso da composição de xampu, sendo que a
fase de rede de gel dispersa tem uma temperatura de transição do material
fundido de pelo menos cerca de 38ºC. Um processo para preparo de uma
composição de xampu compreende as etapas de: (a) combinar um álcool graxo,
um tensoativo secundário e água a uma temperatura suficiente para permitir o
particionamento do tensoativo secundário e da água no álcool graxo, para
formar uma pré-mistura, (b) resfriar a pré-mistura abaixo da temperatura de
fusão da cadeia do álcool graxo, para formar uma rede de gel, (c) adicionar a
rede de gel a um ou mais tensoativos detersivos e a um veículo aquoso, para
formar uma composição de xampu que compreende uma fase de rede de gel
dispersa com uma temperatura de transição do material fundido de pelo menos
cerca de 38ºC.
(71) THE PROCTER & GAMBLE COMPANY (US)
(72) Jennifer Elaine Hilvert, Sarah Elizabeth Cooper, Eric Scott Johnson,
Benjamin Parker Heath
(74) Trench, Rossi e Watanabe Advogados
(85) 14/03/2008
(86) PCT IB2006/052457 de 18/07/2006
(87) WO 2007/031884 de 22/03/2007
(21) PI 0616043-3 A2 (22) 21/11/2006
1.3
(30) 30/11/2005 US 60/741.131
(51) C11D 1/825 (2006.01), C11D 1/83 (2006.01), C11D 1/835 (2006.01)
(54) COMPOSIÇÃO DETERGENTE CONTENDO ALCOXILATO DE ÁLCOOL
RAMIFICADO E TENSOATIVO COMPATIBILIZANTE, E MÉTODO PARA USO
(57) COMPOSIÇÃO DETERGENTE CONTENDO ALCOXILATO DE ÁLCOOL
RAMIFICADO E TENSOATIVO COMPATIBILIZANTE, E MÉTODO PARA USO,
Uma composição detergente é fornecida de acordo com a invenção. A
composição detergente inclui um alcoxilato de álcool ramificado tendo a fórmula
onde R1 é um C2- C2-C20alquila, R2 é H ou um C1- C4 alquila, n é 2-20, e m é 140, e um tensoativo compatibilizante. O tensoativo compatibilizante pode ser
selecionado de modo que uma composição aquosa contendo 5% em peso do
alcoxilato de álcool ramificado e pelo menos 2,5% em peso do tensoativo
compatibilizante forneça uma composição aquosa clara. Uma composição
aquosa clara se refere a uma composição aquosa que seja livre de turvação
visível ao olho nu. Em geral, uma composição aquosa clara se assemelha a
uma composição contendo somente água. Um método para uso da composição
detergente é fornecido.
(71) YVONNE KILLEEN (US) , KIM R. SMITH (US) , MAX GUZMAN (US) ,
STEVEN E. LENTSCH (US)
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 29
(72) YVONNE KILLEEN, KIM R. SMITH, MAX GUZMAN, STEVEN E.
LENTSCH
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/044992 de 21/11/2006
(87) WO 2007/064525 de 07/06/2007
(21) PI 0616044-1 A2 (22) 15/09/2006
1.3
(30) 15/09/2005 US 60/717,466
(51) B65D 47/08 (2006.01), B65D 50/06 (2006.01)
(54) DISPOSITIVO DE FECHAMENTO ARTICULADO
(57) DISPOSITIVO DE FECHAMENTO ARTICULADO. A presente invenção
refere-se a um dispositivo de fechamento articulado (1) preferencialmente
moldado na posição fechada, O dispositivo de fechamento possui uma base (2)
e uma tampa (3) interconectada à base através de um dispositivo articulado (4).
O mecanismo de fechamento (15) mantém o dispositivo de fechamento (1) na
posição com relação a um gargalo (12) e evita a abertura indevida.
(71) CREANOVA UNIVERSAL CLOSURES LTD. (GB)
(72) RODNEY M. DRUITT, LOUIS LAGLER
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/066429 de 15/09/2006
(87) WO 2007/031585 de 22/03/2007
(21) PI 0616045-0 A2 (22) 23/09/2006
1.3
(30) 23/09/2005 FR 05 09740
(51) A61F 2/44 (2006.01)
(54) PRÓTESE DE DISCO INTERVERTEBRAL
(57) PRÓTESE DE DISCO INTERVERTEBRAL. A presente invenção refere-se
a uma prótese de disco intervertebral compreendendo pelo menos duas placas
(1, 2), isto é primeira (1) e segunda (2) placas, articuladas em torno uma da
outra por meio de uma superfície curvada (11, 31), isto é articulação, de pelo
menos uma das placas, cada uma das placas (1, 2) compreendendo uma
superfície (14, 24) conhecida como uma superfície de contato, pretendida para
estar em contato com uma placa vertebral de uma das vértebras entre as quais
a prótese é pretendida ser inserida, essa superfície de contato para cada uma
das placas compreendendo um centro geométrico (G1, G2) em igual distância
de pelo menos dois pontos diametralmente opostos localizados na periferia da
placa (1, 2), caracterizada pelo fato de que os centros geométricos (G1, G2)
das placas (1, 2) não são verticalmente alinhadas, essa descentralização (D)
dos centros geométricos (G1, G2) das placas engendrando uma descentralização das bordas das placas (1, 2) em pelo menos uma direção perpendicular ao
eixo vertical da coluna vertebral.
(71) LDR MEDICAL (FR)
(72) RALPH RASHBAUM, KEE D. KIM, HYUN BAE
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT IB2006/002632 de 23/09/2006
(87) WO 2007/034310 de 29/03/2007
30
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0616046-8 A2 (22) 13/09/2006
1.3
(30) 14/09/2005 JP 2005-267588
(51) A61N 1/30 (2006.01)
(54) DISPOSITIVO PARA IONTOFORESE E DISPOSITIVO DE FONTE DE
ENERGIA ELÉTRICA PARA UM DISPOSITIVO PARA IONTOFORESE
(57) DISPOSITIVO PARA IONTOFORESE E DISPOSITIVO DE FONTE DE
ENERGIA ELÉTRICA PARA UM DISPOSITIVO PARA IONTOFORESE. A
presente invenção refere-se a um dispositivo para lontoforese inclui: um
dispositivo de fonte de energia elétrica; um meio de administração de fármaco
que inclui um conjunto para eletrodo em funcionamento suportando um fármaco
iônico, o conjunto para eletrodo em funcionamento estando conectado ao
dispositivo de fonte de energia elétrica, e um conjunto para eletrodo que não
está em funcionamento suportando um fármaco iônico, o conjunto para eletrodo
que não está em funcionamento servindo como um eletrodo contrário ao
conjunto para eletrodo em funcionamento; e uma unidade de controle de
corrente para controlar uma corrente fluindo para cada um dos conjuntos de
eletrodos por meio de um programa de acordo com o presente padrão. O
fármaco iônico é liberado a partir de cada um dos con- juntos de eletrodos de
acordo com uma corrente fluindo em cada um dos conjuntos de eletrodos para
ser transdermicamente administrado a um orga- nismo. Do referido modo, o
fármaco pode ser administrado de acordo com o padrão de vida de um paciente
e o ritmo cardíaco do fármaco.
(71) TTI ELLEBEAU, INC. (JP)
(72) MIZUO NAKAYAMA, TAKEHIKO MATSUMURA, HIDERO AKIYAMA,
AKIHIKO MATSUMURA
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT JP2006/318174 de 13/09/2006
(87) WO 2007/032398 de 22/03/2007
(21) PI 0616047-6 A2 (22) 08/09/2006
1.3
(30) 14/09/2005 GB 05 18729.9; 28/10/2005 GB 05 21929.0
(51) C07C 33/16 (2006.01), C11B 9/00 (2006.01)
(54) COMPOSTOS TERPENÓIDES TRI OU TETRACÍCLICOS CONTENDO
OXIGÊNIO
(57) COMPOSTOS TERPENÓIDES TRI OU TETRACICLICOS CONTENDO
OXIGÊNIO. A presente invenção refere-se ao uso de um composto de fórmu- a
(l): como um ingrediente de fragrância, em que R1 e Y possuem o mesmo
significado daquele dado na presente descrição e aplicações de fragrância
contendo os ditos compostos.
(71) GIVAUDAN SA (CH)
(72) Jerzy A. Bajgrowicz, Iris Frank
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT CH2006/000484 de 08/09/2006
(87) WO 2007/030963 de 22/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616049-2 A2 (22) 14/09/2006
1.3
(30) 16/09/2005 US 60/717,794; 31/03/2006 US 60/787,865
(51) A61K 8/368 (2006.01), A61K 8/46 (2006.01), A61K 8/73 (2006.01), A61Q
5/02 (2006.01), A61Q 19/10 (2006.01)
(54) COMPOSIÇÕES TÓPICAS ESPUMANTES
(57) COMPOSIÇÕES TÓPICAS ESPUMANTES.Composições tópicas
espumantes aquosas aperfeiçoadas para a aplicação ao corpo humano,
particularmente à pele, composição a qual proporciona um benefício de limpeza
e um benefício anti-microbiano durável.
(71) RECKITT BENCKISER, INC (US)
(72) HAOMING YUAN
(74) Di Blasi, Parente, S. G. & Associados
(85) 14/03/2008
(86) PCT GB2006/003413 de 14/09/2006
(87) WO 2007/031756 de 22/03/2007
(21) PI 0616051-4 A2 (22) 07/09/2006
1.3
(30) 14/09/2005 DE 10 2005 045 666.9
(51) C04B 35/478 (2006.01), B22C 1/18 (2006.01)
(54) CAMADA OU REVESTIMENTO E UMA COMPOSIÇÃO PARA A
PRODUÇÃO DA MESMA
(57) CAMADA OU REVESTIMENTO E UMA COMPOSIÇÃO PARA A
PRODUÇÃO DA MESMA. A presente invenção refere-se a uma composição
para produção de uma camada ou revestimento, especialmente uma camada
de liberação de molde, compreendendo titanato de alumínio e/ou nitrito de
silício, e com- ponente inorgânico oxídico e um ligante compreendendo
partículas em nanoescala. A invenção ainda refere-se a um processo para
produção de uma tal composição, ao seu uso para produção de uma camada
ou um revestimento, a camadas ou revestimentos produzíveis a partir da
composição, e a objetos que foram revestidos pelo menos parcialmente com
uma tal camada ou revestimento.
(71) ITN NANOVATION AG (DE)
(72) STEFAN FABER, RALPH NONNINGER
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/008713 de 07/09/2006
(87) WO 2007/031224 de 22/03/2007
(21) PI 0616053-0 A2 (22) 11/09/2006
1.3
(30) 14/09/2005 US 60/716,516
(51) A23L 1/20 (2006.01), A23L 1/305 (2006.01), A21D 2/26 (2006.01), A23L
1/164 (2006.01), A23L 1/16 (2006.01), A23L 1/314 (2006.01), A23L 1/325
(2006.01), A23J 3/22 (2006.01), A23L 2/66 (2006.01)
(54) PÓS DE PRÉ-MISTURA RICOS EM PROTEÍNA PARA INDÚSTRIA
ALIMENTÍCIA SAUDÁVEL
(57) PÓS DE PRÉ-MISTURA RICOS EM PROTEÍNA PARA INDÚSTRIA
ALIMENTÍCIA SAUDÁVEL. Um concentrado de okara estável é provido, sendo
um pó rico em proteína a ser usado na produção de gêneros alimentícios
saudáveis, enriquecido em proteínas, fibras dietéticas, e livre de colesterol,
essencial- mente consistindo em materiais naturais não contactados com
quaisquer substâncias tóxicas ou danosas durante sua produção. Pré-misturas
úteis para uso na indústria de alimentícia ou doméstico são também providas, O
concentrado pode ser produzido de um subproduto obtido no processamento de
soja. Produtos alimentícios compreendendo o concentrado de okara são
também providos.
(71) ROTEM'S LTD (IL)
(72) ILAN ROTEM, NAVA ALMOG
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT IL2006/001065 de 11/09/2006
(87) WO 2007/032000 de 22/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616054-9 A2 (22) 26/08/2006
1.3
(30) 14/09/2005 EP 05 077086.6
(51) C07K 14/81 (2006.01)
(54) CLIVAGEM DE PRECURSORES DE INSULUNAS POR UMA VARIANTE
DE TRIPSINA
(57) CLIVAGEM DE PRECURSORES DE INSULUNAS POR UMA VARIANTE
DE TRIPSINA. A presente invenção refere-se à produção de uma variante de
tripsina recombinante com especificidade de substrato aumentada para arginina
versus usina, em organismos hospedeiros não-animais. Além disso, a presente
invenção refere-se a uma variante de tripsina recombinante e sua produção.
Também proporcionados estão o uso de variantes de tripsina pancreática
porcina recombinante para clivagem de precursores de insulinas, e kits
contendo a variante de tripsina.
(71) SANOFI-AVENTIS DEUTSCHLAND GMBH (DE)
(72) FRANK GEIPEL, STEPHAN GLASER, CHRISTOPH HOH, ERHARD
KOPETZKI, RAINER MUELLER, FRANK ZOCHER
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/008380 de 26/08/2006
(87) WO 2007/031187 de 22/03/2007
(21) PI 0616055-7 A2 (22) 13/09/2006
1.3
(30) 14/09/2005 US 60/717.560; 15/05/2006 US 60/747.280
(51) A61K 31/513 (2006.01), A61K 31/44 (2006.01), A61P 3/10 (2006.01)
(54) INIBIDORES DE DIPEPTIDIL PEPTIDASE PARA O TRATAMENTO DO
DIABETES
(57) INIBIDORES DE DIPEPTIDIL PEPTIDASE PARA O TRATAMENTO DO
DIABETES São providas composições farmacêuticas compreendendo 2- [6- (3amino-piperidifl-1-il) -3-metil-2,4- benzonitrila e sais farmaceuticamente
aceitáveis da mesma, bem como kits e artigos de fabricação compreendendo as
composições farmacêuticas, bem como métodos de uso das composições
farmacêuticas. As composições podem ser usadas para tratamento do diabetes.
(71) TAKEDA PHARMACEUTICAL COMPANY LIMITED (JP)
(72) Ronald J. Christopher, Paul Covington
(74) FLÁVIA SALIM LOPES
(85) 14/03/2008
(86) PCT US2006/035958 de 13/09/2006
(87) WO 2007/033350 de 22/03/2007
(21) PI 0616056-5 A2 (22) 13/09/2006
1.3
(30) 16/09/2005 US 60/717.706; 16/09/2005 US 60/717.988
(51) C07C 2/66 (2006.01), C07C 6/12 (2006.01), C07C 5/333 (2006.01), C07C
37/08 (2006.01), C07C 15/073 (2006.01), C07C 15/085 (2006.01), C07C 15/02
(2006.01), C07C 15/067 (2006.01)
(54) PROCESSO DE FABRICAÇÃO DE PRODUTOS AROMÁTICOS
(57) PROCESSO DE FABRICAÇAO DE PRODUTOS AROMATICOS Um
processo de fabricação de um composto alquil aromático que compreende
contato de um hidrocarboneto aromático alquilável e um composto aromático
poli alquila em um sistema de transalquilação para render um composto alquil
aromático onde pelo menos uma porção do composto aromático poli alquila foi
formada através de contato de um hidrocarboneto aromático alquilável e uma
olefina em uma localização que é remota do sistema de transalquilação. O
processo ainda pode compreender reação de composto alquil aromático para
produzir um ou mais produtos aromáticos.
(71) Shell Internationale Research Maatschappij B.V (NL)
(72) GARO GARIS VAPORCIYAN
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/035637 de 13/09/2006
(87) WO 2007/035349 de 29/03/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 31
(21) PI 0616057-3 A2 (22) 14/09/2006
1.3
(30) 14/09/2005 US 60/716.524; 19/01/2006 US 60/759.980; 20/01/2006 US
60/760.360; 16/02/2006 US 60/773.669; 27/02/2006 US 60/776.724; 31/03/2006
US 60/787.516; 22/06/2006 US 60/816.022; 18/08/2006 KR 10-2006-0078300
(51) G10L 19/00 (2006.01)
(54) MÉTODO E APARELHO PARA DECODIFICAR UM SINAL DE AÚDIO
(57) MÉTODO E APARELHO PARA DECODIFICAR UM SINAL DE ÁUDIO Um
aparelho para decodificar um sinal de áudio e seu método são apresentados. A
presente invenção inclui o recebimento do sinal de áudio e de informações
espaciais, identificando um tipo de informação espacial modificada, gerando as
informações espaciais modificadas usando as informações espaciais e
decodificando o sinal de áudio usando as informações espaciais modificadas,
em que o tipo da informação espacial modificada inclui pelo menos uma dentre
informações espaciais parciais, informações espaciais combinadas e
informações espaciais expandidas. Por conseguinte, um sinal de áudio pode ser
decodificado em uma configuração diferente de uma configuração decodificada
por um aparelho de codificação. Mesmo que o número de alto-falantes seja
menor ou maior do que o de múltiplos canais, antes da execução de uma
codificação downmixing, o sinal de áudio é capaz de gerar canais de saída
tendo o mesmo número de alto-falantes de um sinal de áudio downmixed.
(71) LG ELECTRONICS, INC (KR)
(72) HEE SUCK PANG, JAE HYUN LIM, DONG SOO KIM, YANG WON JUNG,
HYEN O OH
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT KR2006/003666 de 14/09/2006
(87) WO 2007/032650 de 22/03/2007
(21) PI 0616058-1 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 US 60/719,760; 19/09/2006 US NÃO FORNECIDA
(51) H04L 27/26 (2006.01), H04Q 7/38 (2009.01)
(54) AGRUPAMENTO DE PILOTOS E PROTOCOLOS DE ROTEAMENTO EM
SISTEMAS DE COMUNICAÇÃO MULTIPORTADORA
(57) AGRUPAMENTO DE PILOTOS E PROTOCOLOS DE ROTEAMENTO EM
SISTEMAS DE COMUNICAÇAO MULTIPORTADORA. As modalidades aqui
descritas referem-se a métodos e sistemas para agrupamento de pilotos,
protocolos de roteamento, e programação em sistemas de comunicação
multiportadora. Em uma modalidade, um terminal de acesso pode agrupar uma
pluralidade de sinais piloto caracterizados por freqúências diferentes em um ou
mais grupos de pilotos, cada agrupamento de pilotos sendo identificado por
uma pluralidade de parâmetros (como, por exemplo, um deslocamento PN e um
ID de grupo). Cada grupo de pilotos pode incluir sinais piloto possuindo
substancialmente a mesma área de cobertura. O terminal de acesso pode
também selecionar um sinal piloto representativo de cada grupo de pilotos para
reportar a intensidade de piloto, O terminal de acesso pode também utilizar o
agrupamento de pilotos para gerenciamento eficaz de conjuntos.
(71) QUALCOMN INCORPORATED (US)
(72) PETER JOHN BLACK
(74) Montaury Pimenta, Machado & Lioce
(85) 19/03/2008
(86) PCT US2006/037131 de 22/09/2006
(87) WO 2007/038358 de 05/04/2007
32
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0616059-0 A2 (22) 14/09/2006
1.3
(30) 16/09/2005 EP 05 020209.2
(51) A01N 43/653 (2006.01), A01N 37/34 (2006.01), A01P 3/00 (2006.01)
(54) COMPOSIÇÕES FUNGICIDAS, USO DOS MESMOS, MÉTODO PARA
CONTROLAR FUNGOS FITOPATOGÊNICOS E MATERIAIS INDUSTRIAIS
(57) COMPOSIÇÕES FUNGICIDAS, USO DOS MESMOS, MÉTODO PARA
CONTROLAR FUNGOS FITOPATOGÊNICOS E MATERIAIS INDUSTRIAIS. A
invenção refere-se a uma composição capaz de controlar fungos
fitopatogênicos em uma planta ou material de propagação destes, a referida
composição compreendendo como ingredientes ativos uma mistura de: (A)
Difenoconazol ou um sal ou complexo de metal deste; e (B) Clorota- lonila, em
que o referido Difenoconazol ou o sal ou complexo de metal deste e a referida
Clorotalonila estão presentes na referida composição em quantidades que
produzem um efeito sinergístico. A composição da invenção é da mesma forma
adequada para a proteção de materiais industriais.
(71) SYNGENTA PARTICIPATIONS AG (CH)
(72) JEREMY GODWIN, ERIC GUICHERIT, CHRISTOPH NEUMANN
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 14/03/2008
(86) PCT EP2006/008951 de 14/09/2006
(87) WO 2007/031309 de 22/03/2007
(21) PI 0616060-3 A2 (22) 02/08/2006
1.3
(30) 15/09/2005 ES 050201664
(51) C08L 23/04 (2006.01), C08L 23/08 (2006.01), C08K 3/00 (2006.01)
(54) TUBO OU ARTIGO DE TUBO SUPLEMENTAR E USO DE COMPOSIÇÃO
DE POLIETILENO NA PRODUÇÃO DO MESMO
(57) TUBO OU ARTIGO DE TUBO SUPLEMENTAR E USO DE COMPOSIÇAO
DE POLIETILENO NA PRODUÇAO DO MESMO A presente invenção se refere
a um tubo ou artigo de tubo suplementar compreendendo uma composição de
polietileno, que compreende: (A) uma primeira fração de homopolímero de
etileno; e (B) uma segunda fração de homo- ou copolímero de etileno, em que a
fração (A) tem um peso molecular médio mais baixo do que a fração (B), a
resina de base tem um módulo de flexão determinado de acordo com a norma
ISO 178 igual ou superior a 1.000 MPa, e a composição compreende ainda: (C)
uma carga mineral inorgânica, em que a carga mineral inorgânica (C) está
presente na composição em uma proporção de 1 a 70% em peso. A presente
invenção se refere ainda ao uso da dita composição, na produção de um tubo
ou um artigo de tubo suplementar.
(71) BOREALIS TECHNOLOGY OY (FI)
(72) Carl-Gustaf Ek, Mats Bäckman
(74) Claudia Christina Schulz
(85) 14/03/2008
(86) PCT EP2006/007666 de 02/08/2006
(87) WO 2007/031155 de 22/03/2007
(21) PI 0616061-1 A2 (22) 14/09/2006
1.3
(30) 14/09/2005 GB 0518769.5
(51) A61K 9/12 (2006.01), A61K 9/06 (2006.01), A61K 9/70 (2006.01), A61K
47/32 (2006.01), A61K 47/24 (2006.01), A61K 47/10 (2006.01)
(54) FORMULAÇÃO FARMACÊUTICA CAPAZ DE FORMAR UMA PELÍCULA
QUANDO MINISTRADA NA FORMA TÓPICA; DISPENSADOR EM
AEROSSOL; E MÉTODO PARA O TRATAMENTO DE UMA CONDIÇÃO
ATRAVÉS DE UM FÁRMACO ADEQUADO PARA TRATAR DA DITA
CONDIÇÃO
(57) FORMULAÇÃO ARMACÊUTICA CAPAZ DE FORMAR UMA PELÍCULA
UANDO MINISTRADA NA FORMA TÓPICA; ISPENSADOR EM AEROSSOL; E
MÉTODO PARA O RATAMENTO DE UMA CONDIÇÃO ATRAVÉS DE UM
ÁRMACO ADEQUADO PARA TRATAR DA DITA CONDIÇÃO. Tratam-se de
soluções saturadas, monofásicas de fármaco em uma mistura de solvente e
propelente, juntamente com um agente formador de filme, que exibem fluxos de
difusão transdérmica maiores do que previstas pela lei de Fick quando
aplicadas na forma tópica.
(71) MEDPHARM LIMITED (GB)
(72) MARC BARRY BROWN, STUART ALLEN JONES
(74) TAVARES PROPRIEDADE INTELECTUAL LTDA
(85) 14/03/2008
(86) PCT GB2006/003408 de 14/09/2006
(87) WO 2007/031753 de 22/03/2007
(21) PI 0616062-0 A2 (22) 12/09/2006
1.3
(30) 15/09/2005 NL 1029969; 03/08/2006 NL 1032272
(51) A61B 5/027 (2006.01), A61B 5/053 (2006.01)
(54) MÉTODO PARA DETERMINAR O FLUXO EM UM VASO SANGÜÍNEO, E
DISPOSITIVO PARA DETERMINAR O FLUXO DE UM VASO SANGÜÍNEO
(57) MÉTODO PARA DETERMINAR O FLUXO EM UM VASO SANGUÍNEO, E
DISPOSITIVO PARA DETERMINAR O FLUXO DE UM VASO SANGUÍNEO A
invençào está relacionada a um método e dispositivo para determinar o fluxo
RPI 2109 de 07/06/2011
num vaso sanguíneo, compreendendo a determinação da relação entre a taxa
de cisalhamento e a impedância do sangue que flui, medir a impedância no
seqúência numa seção transversal do vaso sanguíneo, determinar a taxa de
cisalhamento a partir dessa relação e da impedância medida, determinar o
tamanho da seção transversal do vaso sanguíneo, selecionar uma distribuição
teórica relativa de fluxo ao longo da seçâo transversal do vaso sanguíneo,
determinar a velocidade média de fluxo com base na taxa média de
cisalhamento e na distribuição relativa de fluxo, e determinar o volume de fluxo
a partir das determinadas velocidade média de fluxo e seção transversal.
(71) Martil Instruments B.V (NL)
(72) Gheorghe Aurel Marie Pop
(74) Walter de Almeida Martins
(85) 14/03/2008
(86) PCT NL2006/000452 de 12/09/2006
(87) WO 2007/032665 de 22/03/2007
(21) PI 0616063-8 A2 (22) 02/08/2006
1.3
(30) 15/09/2005 ES 050201672
(51) C08K 3/00 (2006.01), C08L 23/04 (2006.01), C08L 23/08 (2006.01), F16L
9/128 (2006.01), F16L 9/12 (2006.01)
(54) TUBO OU ARTIGO DE TUBO SUPLEMENTAR E USO DE COMPOSIÇÃO
DE POLIETILENO NA PRODUÇÃO DO MESMO
(57) TUBO OU ARTIGO DE TUBO SUPLEMENTAR E USO DE COMPOSIÇÃO
DE POLIETILENO NA PRODUÇÃO DO MESMO A presente invenção se refere
a um tubo ou artigo de tubo suplementar compreendendo uma composição de
polietileno, que compreende: (A) uma primeira fração de homopolimero de
etileno; e (E) uma segunda fração de homo- ou copolímero de etileno, em que a
fração (A) tem um peso molecular médio mais baixo do que a fração (B), e a
composição compreende ainda: (C) uma carga mineral inorgânica, em que a
carga mineral inorgânica (C) está presente na composição em uma proporção
de 1 a 70% em peso. A presente invenção se refere ainda ao uso da dita
composição, na produção de um tubo ou um artigo de tubo suplementar.
(71) BOREALIS TECHNOLOGY OY (FI)
(72) Carl-Gustaf Ek, Mats Bäckman
(74) Claudia Christina Schulz
(85) 14/03/2008
(86) PCT EP2006/007667 de 02/08/2006
(87) WO 2007/031156 de 22/03/2007
(21) PI 0616066-2 A2 (22) 12/09/2006
1.3
(30) 16/09/2005 EP 05077113.8
(51) C01F 11/18 (2006.01), C09C 1/02 (2006.01), C09C 3/04 (2006.01), D21H
19/38 (2006.01)
(54) PROCESSO PARA FABRICAR UM MATERIAL DE CARBONATO DE
CÁLCIO CO-MOÍDO, MATERIAL DE CARBONATO DE CÁLCIO CO-MOÍDO,
E, USO DE MATERIAL DE CARBONATO DE CÁLCIO CO-MOÍDO
(57) PROCESSO PARA FABRICAR UM MATERIAL DE CARBONATO DE
CALDO CO-MOÍDO, MATERIAL DE CARBONATO DE CALCIO CO-MOÍDO, E,
USO DE MATERIAL DE CARBONATO DE CALCIO CO- MOIDO Um objetivo
da presente invenção é proporcionar um processo para obter um material de
carbonato de cálcio compreendendo GCC e PCC, com um fator de declive
específico (definido como d30/d70x100, onde dx é o diâmetro esférico equivalente
relativo ao qual x% em peso das partículas são mais finas) de pelo menos cerca
de 30, preferivelmente de pelo menos cerca de 40, e mais preferivelmente de
pelo menos cerca de 45, em uma maneira custo-eficiente, no qual GCC e PCC
são co-moídos, possivelmente com pelo menos outro material mineral. Um
outro objetivo da presente invenção baseia-se no material de carbonato de
cálcio co-moído obtido na forma de uma suspensão aquosa e na forma de um
produto seco. Um outro objetivo da presente invenção baseia-se nos usos de
tais produtos em qualquer setor fazendo uso de materiais minerais, e
notavelmente nas indústrias de papel, de tinta e de plástico.
RPI 2109 de 07/06/2011
(71) Omya Development AG (CH)
(72) CHRISTIAN RAINER, MICHAEL POHL
(74) Momsen, Leonardos & CIA.
(85) 14/03/2008
(86) PCT IB2006/002655 de 12/09/2006
(87) WO 2007/031870 de 22/03/2007
(21) PI 0616067-0 A2 (22) 01/09/2006
1.3
(30) 25/10/2005 US 11/258574
(51) H05B 3/68 (2006.01)
(54) MÉTODOS PARA CONTROLAR UMA COLHEITADEIRA PARA COLHER
UMA SAFRA EM UM CAMPO, PARA DETERMINAR UM TRAJETO DE UMA
COLHEITADEIRA DIRIGÍVEL PARA COLHER UMA SAFRA EM UM CAMPO E
PARA SEGREGAR PRODUTO COLHIDO PARA UMA COLHEITADEIRA
(57) METODOS PARA CONTROLAR UMA COLHEITADEIRA PARA COLHER
UMA SAFRA EM UM CAMPO, PARA DETERMINAR UM TRAJETO DE UMA
COLHEITADEIRA DIRIGÍVEL PARA COLHER UMA SAFRA EM UM CAMPO E
PARA SEGREGAR PRODUTO COLHIDO PARA UMA COLHEITADEIRA Um
método para dividir um campo em zonas com atributos de safra semelhantes e
desenvolver um plano de missão para direcionar a colheitadeira (10) para
colher seletivamente safras baseado em um ou mais dos atributos. Os atributos
incluem nível de proteína, nível de amido, nível de óleo, teor de açúcar, nível de
umidade, nível de nutriente digestível, ou qualquer outra característica de safra
de interesse. O método pode ser aplicado para colher seletivamente e/ou
segregar de acordo com qualquer atributo de safra, incluindo grãos tais como
trigo, milho, ou feijões, frutas tais como uvas, e safras de forragem.
Amostragem de safra dirigida provê valor absoluto e informação de variância
para lotes segregados de safra colhida.
(71) DEERE & COMPANY (US)
(72) Larry Lee Hendrickson, Terence Daniel Pickett, Stephen Michael Faivre
(74) MOMSEN LEONARDOS & CIA
(85) 14/03/2008
(86) PCT US2006/034278 de 01/09/2006
(87) WO 2007/050192 de 03/05/2007
(21) PI 0616068-9 A2 (22) 14/09/2006
1.3
(30) 15/09/2005 US 11/229056
(51) B01D 53/50 (2006.01)
(54) MÉTODOS DE REMOÇÃO DE SO3 DE UMA CORRENTE DE GÁS DE
COMBUSTÃO, E DE FORNECIMENTO DE UM SORVENTE SECO PARA
INJEÇÃO DE GÁS DE COMBUSTÃO
(57) MÉTODOS DE REMOÇÃO DE SO3 DE UMA CORRENTE DE GÁS DE
COMBUSTÃO, E DE FORNECIMENTO DE UM SORVENTE SECO PARA
INJEÇÃO DE GÁS DE COMBUSTÃO A invenção refere-se a um método de
remoção de SO3de uma corrente de gás de combustão tendo quantidades
aumentadas de SO3 formado por um sistema de remoção de NOx, que inclui a
injeção de uma composição sorvente na corrente de gás de combustão. A
composição sorvente inclui um aditivo e um sorvente de sódio, tal como trona
mecanicamente refinada ou bicarbonato de sódio. O aditivo é selecionado
dentre carbonato de magnésio, carbonato de cálcio, hidróxido de magnésio,
hidróxido de cálcio, e misturas destes. A concentração do SO3 na corrente de
gás de combustão é reduzida e a formação de um produto de reação de
NaHSO4 em fase líquida é minimizada.
(71) SOLVAY CHEMICALS INC. (US)
(72) JOHN MAZIUK, JR., RASIK RAYTHATHA
(74) MOMSEN LEONARDOS & CIA
(85) 14/03/2008
(86) PCT EP2006/066359 de 14/09/2006
(87) WO 2007/031552 de 22/03/2007
(21) PI 0616069-7 A2 (22) 15/09/2006
1.3
(30) 16/09/2005 US 60/717.597
(51) C12N 15/11 (2006.01)
(54) MODULAÇÃO DE PROPRIEDADES IMUNOMODULADORAS DE ÁCIDO
RIBONUCLÉICO INTERFERENTE PEQUENO (SIRNA) ATRAVÉS DE
MODIFICAÇÃO DE NUCLEOTÍDEO
(57) MODULAÇÀO DE PROPRIEDADES IMUNOMODULADORAS DE ÁCIDO
RIBONUCLÉICO INTERFERENTE PEQUENO (SIRNA) ATRAVÉS DE
MODIFICAÇAO DE NUCLEOTIDEO Ácido ribonucléico interferente pequeno de
fita dupla (SIRNA) são modificados para redução ou eliminação de seu efeito
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 33
imunoestimulador sem afetar significantemente seu efeito de silenciamento de
gene. SIRNA modificado inclui uma ou mais modificações de açúcar 2' e,
opcionalmente, ligações de inter-nucleotídeo na fita senso. Composições
contendo o SIRNA modificado e processos de fabricação e de uso de SIRNA
modificado são mostrados. SIRNA novo e previamente caracterizado pode ser
sintetizado para incorporar modificações de acordo com a invenção.
(71) COLEY PHARMACEUTICAL GMBH (DE) , qiagen gmbh (DE)
(72) Marion Jurk, Jorg Vollmer, Christian Schetter, Martin Weber, Ioanna
Andreou, Stefan Pitsch, Eugen Uhlmann
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT IB2006/003356 de 15/09/2006
(87) WO 2007/031877 de 22/03/2007
(21) PI 0616070-0 A2 (22) 14/11/2006
1.3
(30) 16/12/2005 US 11/303.625
(51) B01J 23/30 (2006.01), B01J 37/34 (2006.01), B01D 53/86 (2006.01), B01J
21/06 (2006.01), B01J 35/02 (2006.01), B01J 37/08 (2006.01), C01B 13/34
(2006.01)
(54) MÉTODO DE PREPARAÇÃO DE CATALISADOR DeNOx
(57) MÉTODO DE PREPARAÇAO DE CATALISADOR DeNOx A invenção é um
método para a produção de um catalisador de óxido de metal útil para purificar
gases de descarga e gases residuais a partir dos processos de combustão. O
método compreende reagir um precursor de dióxido de titânio, um precursor de
óxido de vanádio, e um precursor de óxido de tungstênio na presença de
oxigênio em uma temperatura de pelo menos 1000ºC.
(71) Millennium Inorganic Chemicals, INC. (US)
(72) Kamal M. Akhtar, Steven M. Augustine
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/044220 de 14/11/2006
(87) WO 2007/078435 de 12/07/2007
(21) PI 0616071-9 A2 (22) 14/09/2006
1.3
(30) 14/09/2005 US 60/717.524; 14/04/2006 US 60/744.882
(51) A61K 9/16 (2006.01)
(54) MÉTODO DE FORMULAÇÃO DE FÁRMACO COM BASE NO AUMENTO
DA AFINIDADE DE SUPERFÍCIES DE MICROPARTÍCULAS CRISTALINAS
PARA AGENTES ATIVOS
(57) MÉTODO DE FORMULAÇÃO DE FÁRMACO COM BASE NO AUMENTO
DA AFINIDADE DE SUPERFÍCIES DE MICROPARTÍCULAS CRISTALINAS
PARA AGENTES ATIVOS Métodos são fornecidos para revestir micropartículas
cristalinas com um agente ativo através da alteração das propriedades de
superfície das micropartículas a fim de facilitar a associação favorável na
microparticula pelo agente ativo. Tipo de propriedades de superfície que são
alteradas pelos métodos descritos inclui propriedades eletrostáticas,
propriedades hidrofóbicas e propriedades de ligação de hidrogênio.
(71) MANNKIND CORPORATION (US)
(72) KEITH A. OBERG
(74) NELLIE ANNE DANIEL SHORES
(85) 14/03/2008
(86) PCT US2006/036034 de 14/09/2006
(87) WO 2007/033372 de 22/03/2007
(21) PI 0616072-7 A2 (22) 15/09/2006
1.3
(30) 16/09/2005 AU 2005905131; 16/09/2005 AU 2005905130; 28/03/2006 US
60/786.365
(51) A01N 33/18 (2006.01), A01N 35/04 (2006.01), A01N 43/10 (2006.01),
A01N 25/22 (2006.01), A01N 37/34 (2006.01), A01N 43/90 (2006.01)
(54) COMPOSIÇÃO DE HERBICIDA
(57) COMPOSIÇÃO DE HERBICIDA A invenção se refere a uma composição
herbicida compreendendo de aproximadamente 30 a aproximadamente 70%
em peso da composição, de pelo menos um herbicida de dinitroanilina; um
solvente orgânico tendo um ponto de fulgor superior a 60,5ºC; e acetofenona
em uma quantidade na faixa de 5-25% em peso. A invenção também se refere
a um método de controlar as ervas daninhas o qual utiliza a composição.
(71) Nufarm Australia Limited (AU)
(72) ARISTOS PANAYI, CHAD RICHARD ORD SAYER, ANDREW JOHN
WELLS
(74) FLÁVIA SALIM LOPES
(85) 14/03/2008
(86) PCT AU2006/001355 de 15/09/2006
(87) WO 2007/030887 de 22/03/2007
(21) PI 0616073-5 A2 (22) 30/08/2006
1.3
(30) 15/09/2005 JP 2005-268386
(51) C08L 15/00 (2006.01), B60C 1/00 (2006.01), C08K 3/00 (2006.01), C08L
25/10 (2006.01)
(54) COMPOSIÇÃO DE BORRACHA E PNEU FEITO DA MESMA
(57) COMPOSIÇÃO DE BORRACHA E PNEU FEITO DA MESMA Esta
invenção provê uma composição de borracha tendo excelente trabalhabilidade,
características de fratura e resistência ao desgaste e baixo acúmulo de calor, a
qual compreende não menos do que 20 partes em massa de uma carga de
reforço (B) e 5 a 60 partes em massa de um copolímero de composto de dieno
conjugado com composto de vinil aromático modificado (C) tendo pelo menos
um grupo funcional, um teor de composto de vinil aromático de 5 a 80% em
massa, um teor de ligação de vinil em uma porção de composto de dieno
conjugado de 10 a 80% em massa e um peso molecular médio ponderal como
medido através de uma cromatografia de permeação em gel e convertido em
poliestireno de 5.000 a 500.000 com base em 100 partes em massa de um
componente de borracha (A) contendo não menos do que 10% em massa de
um polímero com base em dieno conjugado modificado tendo pelo menos um
grupo funcional.
(71) BRIDGESTONE CORPORATION (JP)
(72) NAOHISA JINBO, NORIKO MORI
34
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(74) Montaury Pimenta, Machado & Lioce S/C Ltda
(85) 14/03/2008
(86) PCT JP2006/317093 de 30/08/2006
(87) WO 2007/032209 de 22/03/2007
(21) PI 0616074-3 A2 (22) 15/09/2006
1.3
(30) 15/09/2005 US 60/717,620; 25/10/2005 US 60/730,312; 09/12/2005 US
60/749,294; 09/12/2005 US 60/749,233; 14/09/2006 US 11/532,044
(51) H04Q 7/38 (2009.01)
(54) SUPORTE DE CHAMADA EM MODO CIRCUITO DE EMERGÊNCIA
(57) SUPORTE DE CHAMADA EM MODO DE CIRCUITO DE EMERGÊNCIA
Técnicas para suportar as chamadas em modo de circuito de emergência são
descritas. As técnicas podem ser utilizadas para várias redes 3GPP e 3GPP2,
várias arquiteturas de localização, e vários tipos de Equipamento de Usuário
(UE). Um UE estabelece uma chamada em modo de circuito com uma rede
sem fio para serviços de emergência. O UE interage com um servidor de
localização indicado pela rede sem fio. O UE realiza a localização de plano de
usuário com o servidor de localização durante a chamada em modo de circuito
para obter uma estimativa de posição para o UE. O UE comunica com um
PSAP, que pode ser selecionado com base na estimativa de posição, para a
chamada em modo de circuito de emergência. O UE pode realizar o
posicionamento com o servidor de localização para obtenção de uma estimativa
de posição atualizada para o UE, por exemplo, toda vez que for solicitado pelo
PSAP.
(71) QUALCOMM INCORPORATED (US)
(72) STEPHEN EDGE, KIRK BURROUGHS, ANDREAS WACHTER
(74) MONTAURY PIMENTA, MACHADO & LIOCE
(85) 14/03/2008
(86) PCT US2006/036488 de 15/09/2006
(87) WO 2007/035736 de 29/03/2007
(21) PI 0616075-1 A2 (22) 13/09/2006
1.3
(30) 16/09/2005 EP 05077117.9
(51) C08F 4/76 (2006.01), C07F 7/28 (2006.01)
(54) PROCESSO PARA A PREPARAÇÃO DE UM COMPOSTO
ORGANOMETÁLICO COMPREENDENDO UM LIGANTE ESPECTADOR
(57) PROCESSO PARA A PREPARAÇÃO DE UM COMPOSTO
ORGANOMETÁLICO COMPREENDENDO UM LIGANTE ESPECTADOR A
invenção se refere a um processo para a produção de um composto
organometálico de fórmula (1): MALjYrX(p-(n+v+r))Rn (fórmula 1) onde: M é um
metal dos grupos 3-13 ou da série dos lantanídeos, e p é a valência do metal M,
A representa um ligante espectador aniônico cuja valência v é 1 ou 2, Y é um
ligante espectador representado pela fórmula 2: onde o ligante espectador está
ligado ao metal M por covalência, via o átomo de nitrogênio da imina, Subl é um
substituinte que compreende um átomo do grupo 14, através do qual Subl está
ligado ao átomo de carbono da imina. Sub2 é um substituinte que compreende
um átomo dos grupos 15-16, através do qual Sub2 está ligado ao átomo de
carbono da imina, Subl e Sub2 podem ser conectados um ao outro para formar
um sistema de anel, r é um inteiro > O, L é um ligante opcional neutro base de
Lewis, e j é um inteiro denotando o número de ligantes neutros L, x é um haleto
e R é um ligante aniônico, em que um reagente organometálico de fórmula (3),
MALjXp-v (fórmula 3), é colocado em contato com um agente de alquilação,
assim formando um precursor no qual ao menos um dos átomos de haleto é
substituído por um ligante aniônico R, que pode ser independentemente
selecionado dentre os grupos alquila, aril-alquila, arila ou uma combinação
destes, precursor este que subsequentemente entra em contato com uma imina
de acordo com a fórmula 2.
(71) DSM IP ASSETS B.V. (NL)
(72) Edwin Gerard Ijpeij, Martin Alexander Zuideveld, Henricus Johannes Arts,
Francis Van Der Burgt, Gerardus Henricus Josephus Van Doremaele
(74) Flávia Salim Lopes
(85) 14/03/2008
(86) PCT EP2006/008916 de 13/09/2006
(87) WO 2007/031295 de 22/03/2007
(21) PI 0616076-0 A2 (22) 11/09/2006
1.3
(30) 16/09/2005 SE 0502043-3
(51) A61K 47/44 (2006.01), A61K 9/107 (2006.01), A61K 47/04 (2006.01), A61K
47/36 (2006.01), A61K 9/20 (2006.01), A61K 9/48 (2006.01)
(54) COMPOSIÇÃO FARMACÊUTICA DE LIPÍDIO PARTICULADA
(57) COMPOSIÇÃO FARMACÊUTICA DE LIPÍDIO PARTICULADA Uma
composição farmacêutica de lipídio particulada compreende um veículo nãolipídio sólido particulado e uma emulsão de óleo-em-água sobre o veículo. A
emulsão compreende um agente farmacologicamente ativo dissolvido ou
disperso. A emulsão de óleo-em-água é liberada do veículo em contato com um
meio aquoso para formar uma emulsão de óleo-em-água no meio. É também
descrito um processo para a produção da composição e de um tablete contendo
a mesma; de sachês e cápsulas preenchidas com a composição; o uso da
composição e o tablete como um medicamento; um processo para a
administração da composição a um paciente.
(71) DSM IP ASSETS B.V. (NL)
(72) BENGT HERSLOF, PER TINGVALL, ANNA KORNFELDT
(74) FLÁVIA SALIM LOPES
(85) 14/03/2008
(86) PCT SE2006/001033 de 11/09/2006
(87) WO 2007/032727 de 22/03/2007
(21) PI 0616077-8 A2 (22) 13/09/2006
1.3
(30) 14/09/2005 US 60/717.558; 15/05/2006 US 60/747.273
(51) A61K 31/513 (2006.01), A61K 31/44 (2006.01), A61K 31/131 (2006.01),
A61P 3/10 (2006.01)
(54) ADMINISTRAÇÃO DE INIBIDORES DE DIPEPTIDIL PEPTIDASE
(57) ADMINISTRAÇÃO DE INIBIDORES DE DIPEPTIDIL PEPTIDASE São
providas composições farmacêuticas compreendendo 2- [[5-[(3R)-3-amino-1piperidifinil]-3,4-diidro-3-metil-2,4-dioxo-1(2H)Pirí midinil]metíl] - benzonitrila e
sais farmaceuticamente aceitáveis da mesma, bem como kits e artigos de
manufatura compreendendo as composições farmacêuticas, bem como
métodos de uso das composições farmacêuticas.
(71) TAKEDA PHARMACEUTICAL COMPANY LIMITED (JP)
(72) RONALD J. CHRISTOPHER, PAUL COVINGTON
(74) FLÁVIA SALIM LOPES
(85) 14/03/2008
(86) PCT US2006/035708 de 13/09/2006
(87) WO 2007/033266 de 22/03/2007
(21) PI 0616078-6 A2 (22) 12/09/2006
1.3
(30) 15/09/2005 US 60/717,200
(51) A61K 9/00 (2006.01), A61K 9/14 (2006.01), A61K 9/28 (2006.01), A61K
9/48 (2006.01), A61K 31/00 (2006.01), A61K 31/74 (2006.01), A61K 31/785
(2006.01)
(54) FORMULAÇÃO EM SACHÊ E PÓ PARA POLÍMEROS DE AMINA E O
RESPECTIVO USO DA FORMULAÇÃO
(57) FORMULAÇÃO EM SACHE E PÓ PARA POLÍMEROS DE AMINA E O
RESPECTIVO USO DA FORMULAÇÃO. Uma formulação em pó compreende
um estabilizador anlânico farmaceuticamente aceitável e um polímero de amina
alifática ou sal farmaceuticamente aceitável do referido polímero misturado ao
estabilizador aniânico. A formulação em pó é convenientemente embalada em
um recipiente, tal como um sachê, é utilizada no tratamento de um individuo
com hiperfosfatemia.
(71) GENZYME CORPOTATION (US)
(72) Hitesh R. Bhagat, Jeffrey M. Goldberg
(74) VIEIRA DE MELLO ADVOGADOS
(85) 14/03/2008
(86) PCT US2006/035370 de 12/09/2006
(87) WO 2007/035313 de 29/03/2007
(21) PI 0616079-4 A2 (22) 01/09/2006
1.3
(30) 07/09/2005 US 60/714,260
(51) H04H 1/00 (2008.01), H04N 5/445 (2011.01)
(54) SINALIZAÇÃO DE INDENTIFICAÇÃO DA CÉLULA EM GUIA DE
SERVIÇO DE RADIODIFUSÃO MÓVEL DIGITAL PARA RADIODIFUSÃO
LOCALIZADA
(57) SINALIZAÇÃO DE IDENTIFICAÇÃO DA CÉLULA EM GUIA DE SERVIÇO
DE RADIODIFUSÃO MÓVEL DIGITAL PARA RADIODIFUSÃO LOCALIZADA.
Trata-se de aparelhos e métodos para proporcionar uma transmissão de
programa ou serviço com fragmento(s) ESG associado(s) a um receptor em um
local designado. Parâmetros, elementos ou subelementos podem ser incluídos
em um guia de serviço ou em outro fragmento de dados que indica o local onde
o programa, serviço e fragmento(s) ESG correspondente(s) podem ser
difundidos via rádio. Por exemplo, uma identificação da célula pode ser indicada
como um elemento ou subelemento em um fragmento ESG para indicar o local
onde um prógrama ou serviço pode ser difundido via rádio. Da mesma forma,
as identificações da célula podem ser agrupadas para indicar uma região maior
RPI 2109 de 07/06/2011
onde se difunde via rádio um programa ou serviço e fragmento(s) ESG
correspondente(s) em um guia de serviço.
(71) NOKIA CORPORATION (FI)
(72) MARTTA SEPPÄLÄ
(74) Araripe & Associados
(85) 03/03/2008
(86) PCT IB2006/002427 de 01/09/2006
(87) WO 2007/029090 de 15/03/2007
(21) PI 0616080-8 A2 (22) 08/09/2006
1.3
(30) 09/09/2005 US 60/718,836
(51) H04B 17/00 (2006.01), H04Q 7/38 (2009.01), H04L 12/28 (2006.01)
(54) MÉTODO; MÉTODO DE OBTENÇÃO DE UMA INFORMAÇÃO DE
RELATÓRIO DA RÁDIO-MEDIÇÃO NUMA REDE DE COMUNICAÇÃO SEM
FIO; EQUIPAMENTO; E PRODUTO PROGRAMA DE COMPUTADOR PARA
COMUNICAÇÕES SEM FIO
(57) MÉTODO; MÉTODO DE OBTENÇÃO DE UMA INFORMAÇÃO DE
RELATÓRIO DA RÁDIO-MEDIÇÃO NUMA REDE DE COMUNICAÇÃO SEM
FIO; EQUIPAMENTO; E PRODUTO PROGRAMA DE COMPUTADOR PARA
COMUNICAÇÕES SEM FIO. Trata-se de diversas modalidades que são
reveladas com relação ao uso de um piloto de medição para a rádio-medição
numa rede de comunicação sem fio, como, por exemplo, para uso na medição e
geração de informação de relatórios de sinais de balizamentos. Numa
modalidade representativa, uma solicitação de rádio-medição (300) pode ser
recebida proveniente de um nó sem fio solicitante (104, 114) e um quadro piloto
de medição (200) pode ser recebido proveniente de um ou mais nós sem fios
(104, 106, 108, 114, 118, 116). Uma informação de relatório da rádio-medição
(500) pode ser gerada com base, pelo menos em parte, no quadro piloto de
medição (200) proveniente de um ou mais nós sem fios. A informação de
relatório da rádio-medição (500) pode ser transmitida para o nó sem fio
solicitante (104,114).
(71) NOKIA CORPORATION (FI)
(72) PAIVIN M. RUUSKA
(74) Araripe & Associados
(85) 03/03/2008
(86) PCT IB2006/002476 de 08/09/2006
(87) WO 2007/029109 de 15/03/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 35
(21) PI 0616081-6 A2 (22) 06/07/2006
1.3
(30) 12/09/2005 IN 1268/CHE/2005
(51) A61K 31/12 (2006.01), C07F 9/28 (2006.01)
(54) TRIIDRATO CRISTALINO DE ÁCIDO ZOLEDRÔNICO
(57) TRIIDRATO CRISTALINO DE ÁCIDO ZOLEDRÔNICO Triidrato de ácido
zoledrônico, processos para sua preparação, e conversão em monoidrato de
ácido zoledrônico.
(71) REDDY'S LABORATORIES, INC. (US) , REDDY'S LABORATORIES LTD.
(IN)
(72) PRADEEP KUMAR MOHAKHUD, VEERENDER MURKI, KISHORE BABU
NANDAMUDI, MOSES BABU, SURAJIT BANERJEE
(74) Araripe & Associados
(85) 11/03/2008
(86) PCT US2006/026153 de 06/07/2006
(87) WO 2007/032808 de 22/03/2007
(21) PI 0616082-4 A2 (22) 08/09/2006
1.3
(30) 20/09/2005 DE 20 2005 014 864.4
(51) B65B 13/06 (2006.01)
(54) DISPOSITIVO PARA A CINTAGEM E EMBALAGENS E RÉGUA
PERFILADA, ESPECIALMENTE PARA COBRIR O CANAL DA CINTA DO
DISPOSITIVO DE CINTAGEM DE EMBALAGENS
(57) DISPOSITIVO PARA A CINTAGEM DE EMBALAGENS E RÉGUA
PERFILADA, ESPECIALMENTE PARA COBRIR O CANAL DA CINTA DO
DISPOSITIVO DE CINTAGEM DE EMBALAGENS. Dispositivo para cintagem
de embalagens, no qual o canal da cinta (28) do quadro condutor da cinta (13) é
coberto por réguas perfiladas, as quais consistem em material elástico, de
preferência de uma massa de moldagem de elastômero de poliuretana
endurecível elasticamente, no qual estão embutidos como elementos de
desgaste e/ou deslizamento em forma de elementos de molas espirais
metálicas (34), cujos eixos de mola helicoidal projetam-se essencialmente em
paralelo para como canal da cinta (28) e cujas voltas salientam-se um
determinado trecho fora do material elástico dentro do canal da cinta (28),
formando faces deslizantes (35) curvadas essencialmente projetadas
transversalmente para com o canal da cinta, de maneira que a cinta de
cintagem, ao sair do canal da cinta, essencialmente apenas estabelecem
contato com as faces deslizantes metálicas dos elementos molares, não
danificando, portanto, o material elástico das réguas perfiladas.
(71) Cyklop GMBH (DE)
(72) MASCHINENFABRIK GERD MOSCA AG, DIETER KOPITZ, UDO REICHE
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT EP2006/008779 de 08/09/2006
(87) WO 2007/033775 de 29/03/2007
(21) PI 0616083-2 A2 (22) 14/09/2006
1.3
(30) 19/09/2005 DE 20 2005 014 738.9
(51) B65D 5/00 (2006.01)
(54) RECIPIENTE E PEÇA EM BRUTO PARA A PRODUÇÃO DO MESMO
(57) RECIPIENTE E PEÇA EM BRUTO PARA A PRODUÇÃO DO MESMO. A
presente invenção refere-se a um recipiente (1) para armazenar e remover
alimentos, que compreende uma primeira e uma segunda metades (2, 3) que
são conectadas entre si por meio de uma conexão pivotável a fim de pivotar
entre uma posição aberta (4) e uma posição fechada (5). Para aperfeiçoar tal
recipiente com a finalidade de que seja também ade- quado para o consumo do
alimento e possa ser simultaneamente produzido de uma forma mais estável e
econômica enquanto é fácil de ser montado, cada metade de recipiente (2, 3)
compreende uma parede poligonal superior e inferior (7, 8; 9, 10), quando visto
a partir de cima, e uma parede lateral (11,12) que conecta as paredes em uma
distância entre si, onde a conexão pivotável é concretizada por uma linha
pivotável concretizada entre as primeiras extremidades viradas (13,14) das
paredes laterais (11,12), e assegundas extremidades (15,16) das paredes
laterais (11,12) estão na posição fechada (5) destacavelmente conectadas entre
si, onde o eixo pivotável (17) associado à linha pivotável (6) se estende
essencialmente perpendicular às paredes superior e inferior (7, 9; 8,10). Além
disso, é provida uma peça em bruto de uma só parte (60) para produzir tal
recipiente (1).
(71) Seda S.P.A (IT)
(72) GIANFRANCO D'AMATO
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT EP2006/008983 de 14/09/2006
36
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(54) POLÍMERO REISTENTE A ARRANHÕES, BEM COMO COMPOSIÇÕES
DE REVESTIMENTO E MÉTODO PARA PROVER RESISTÊNCIA A
ARRANHÔES
(57) POLÍMERO RESISTENTE A ARRANHÕES, BEM COMO COMPOSIÇÕES
DE REVESTIMENTO E MÉTODO PARA PROVER RESISTÊNCIA A
ARRANHÕES. Substratos de polímeros, por exemplo, ABS, PBT, PVC, PET,
náilon 6, náilon 6'6, ABS/PBT, PC/ABS ou ionômeros; e composições de
revestimento, por exemplo, revestimentos à base de óleo ou água com resinas
alquídicas, acrílicas, acrílico-alquídicas, poliéster, fenólicas, melamina, epóxi ou
poliuretano, são tornadas resistentes a arranhões mediante incorporação de
uma combinação aditiva de b) um polímero ou copolímero de olefina
funcionalizada reagente a ácido carboxílico e c) uma amida de ácido graxo
primário ou secundário. Os presentes polímeros e revestimentos exibem uma
satisfatória durabilidade ao desgaste, resistência a arranhões, satisfatória
processabilidade, satisfatória resistência mecânica, satisfatória retenção de
brilho e não são pegajosas. O polímero de olefina funcionalizada reagente a
ácido carboxilico é, por exemplo, polipropileno ou polietileno enxertado, por
exemplo, com anidrido maléico ou é um produto de reação de anidrido maléico
e uma alfa-olefina ou é um éster de álcool de sebo dos ditos produtos de
anidrido maléico. A amida de ácido graxo, por exemplo, é uma oleil paímitamida
ou estearil erucamida.
(71) CIBA SPECIALTY CHEMICALS HOLDING INC (CH)
(72) Ashutosh H. Sharma, Peter Shelsey Solera, Sarah Root Kaspers
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT EP2006/066315 de 13/09/2006
(87) WO 2007/039421 de 12/04/2007
(87) WO 2007/033794 de 29/03/2007
(21) PI 0616084-0 A2 (22) 21/09/2006
1.3
(30) 23/09/2005 HU P0500886
(51) C07C 233/35 (2006.01), C07C 323/63 (2006.01), A61K 31/4965 (2006.01)
(54) DERIVADOS DE AMINO-ALQUIL-AMIDA COMO LIGANTES DE
RECEPTORES CCR3
(57) DERIVADOS DE AMINO-ALQUIL-AMIDA COMO LIGANTES DE
RECEPTORES CCR3. A presente invenção refere-se aos ligantes de
receptores CCR3 da fórmula geral (l), dentro deles favoravelmente aos
antagonistas, e aos sais, solvatos e isômeros deles, às composições
farmacêuticas que os contêm, ao uso dos compostos da fórmula geral (l) e de
seus sais, solvatos e isômeros e à preparação dos compostos da fórmula geral
(l) e de seus sais, solvatos e isômeros.
(71) SANOFI-AVENTIS (FR)
(72) Sándor Bátori, Márton Varga, Endre Mikus, Katalin Urbán-Szabó, Judit
Vargáné Szeredi, Tibor Szabó, Marianna Kovács, LajosT.Nagy, Ágnes Pappné
Behr, Zoltán Kapui, Péter Arányi, Veronika Bartáné Bodor, Edit Susán
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT HU2006/000080 de 21/09/2006
(87) WO 2007/034254 de 29/03/2007
(21) PI 0616088-3 A2 (22) 18/09/2006
1.3
(30) 19/09/2005 FR 05 09558
(51) F16D 41/20 (2006.01)
(54) POLIA DE TRANSMISSÃO DE ENERGIA
(57) POLIA DE TRANSMISSÃO DE ENERGIA. A presente invenção refere-se a
uma polia de transmissão de energia compreendendo um elemento de polia
(200) tendo um contorno externo estriado (201) que é adaptado para receber
uma correia estria, e um elemento resiliente (206) interposto entre o elemento
de polia (200) e um dispositivo receptor (203) para acoplar a um elemento
acionado pela correia. A polia inclui um dispositivo de roda livre (204) disposto
em série com o elemento resiliente (206) entre o elemento de polia (200) e o
dito elemento receptor (203).
(71) HUTCHINSON (FR)
(72) HENRI KAMDEM, CLAUDE ROINTRU
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT FR2006/002130 de 18/09/2006
(87) WO 2007/034060 de 29/03/2007
(21) PI 0616085-9 A2 (22) 30/08/2006
1.3
(30) 22/09/2005 DE 10 2005 045 458.5
(51) C08F 293/00 (2006.01)
(54) PROCESSO PARA PREPARAÇÃO DE COPOLÍMEROS TRIBLOCO ABA
À BASE DE (MET)ACRILATO
(57) PROCESSO PARA PREPARAÇÃO DE COPOLÍMEROS TRIBLOCO ABA
À BASE DE (MET)ACRILATO. A invenção refere-se a um processo para a
preparação de copolímeros tribloco ABA à base de (met)acrilatos com uma
funcionalização olefínica dos blocos A.
(71) EVONIK RÖHM GMBH (DE)
(72) SVEN BALK, MONIKA MÄRZ, CHRISTINE TRÖMER, GERD LÖHDEN
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT EP2006/065790 de 30/08/2006
(87) WO 2007/033887 de 29/03/2007
(21) PI 0616086-7 A2 (22) 31/08/2006
1.3
(30) 20/09/2005 FI 20055503
(51) C08B 37/08 (2006.01), C08B 31/04 (2006.01), C07D 295/15 (2006.01)
(54) POLÍMEROS QUATERNÁRIOS
(57) POLÍMEROS QUATERNÁRIOS. A presente invenção refere-se a
polímeros quaternizados, especialmente do tipo quitina/quitosana, e a
polímeros de carboidrato carregando grupos de amônio quaternizado,
especialmente grupos piperazínio. Tais polímeros são caracterizados, i.a., por
características de solubilidade aperfeiçoadas.
(71) FENNOPHARMA OY (FI)
(72) JUKKA HOLAPPA, TOMI JÄRVINEN, TAPIO NEVALAINEN, JOUKO
SAVOLAINEN, RUSTAM SAFIN
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT FI2006/050373 de 31/08/2006
(87) WO 2007/034032 de 29/03/2007
(21) PI 0616087-5 A2 (22) 13/09/2006
(30) 22/09/2005 US 60/719,358; 22/09/2005 US 60/719,357
(51) C08L 51/06 (2006.01), C08K 5/20 (2006.01)
1.3
(21) PI 0616089-1 A2 (22) 18/08/2006
1.3
(30) 23/09/2005 DE 10 2005 045 746.0; 18/02/2006 DE 10 2006 007 586.2
(51) F01L 1/344 (2006.01)
(54) UNIDADE DE ACIONAMENTO VARIÁVEL PARA EIXOS DE
EXCÊNTRICOS
(57) UNIDADE DE ACIONAMENTO VARIAVEL PARA EIXOS DE
EXCÊNTRICOS. Rotor (2) e/ou caixa de rotor (1) para um regulador de eixo de
excêntricos para motores de veículos automotores e processo para a produção
dos mesmos.
(71) NEUMAYER TEKFOR HOLDING GMBH (DE)
(72) RAINER STÜCKRAD, STEFAN MALM, HELMUT STRAUB, WALTER
RICHTER
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT DE2006/001454 de 18/08/2006
(87) WO 2007/033634 de 29/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616090-5 A2 (22) 19/09/2006
1.3
(30) 19/09/2005 US 60/718,501; 12/10/2005 US 60/725,680
(51) G01N 33/574 (2006.01), G01N 33/48 (2006.01)
(54) MÉTODOS E MATERIAIS PARA IDENTIFICAÇÃO DA ORIGEM DE UM
CARCINOMA DE ORIGEM PRIMÁRIA DESCONHECIDA
(57) MÉTODOS E MATERIAIS PARA IDENTIFICAÇÃO DA ORIGEM DE UM
CARCINOMA DE ORIGEM PRIMÁRIA DESCONHECIDA. A presente invenção
refere-se a um método de identificação da origem de uma metástase de origem
desconhecida pela obtenção de uma amostra contendo células metastáticas; a
medição de Biomarcadores associados a, pelo menos, dois carcinomas
diferentes; a combinação dos dados dos Biomarcadores em um algoritmo, em
que o aígoritmo normaliza os Biomarcadores contra uma referência e impõe um
limite de corte que otimiza a sensibilidade e especificidade de cada
Biomarcador, pondera a prevalência dos carcinomas e seleciona um tecido de
origem; a determinação da origem com base na probabilidade mais alta,
determinada pelo algoritmo, ou a determinação que o carcinoma não é derivado
de um conjunto de carcinomas em particular; e, opcionalmente, a medição de
Biomarcadores específicos para um ou mais carcinomas adicionais diferentes e
a repetição das etapas para Biomarcadores adicionais.
(71) Veridex, LLC (US)
(72) Yixin Wang, Dimitri Talantov, Timothy Jatkoe, Jonathan Baden, Abhijit
Mazumder
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT US2006/036355 de 19/09/2006
(87) WO 2007035676 de 29/03/2007
(21) PI 0616092-1 A2 (22) 20/09/2006
1.3
(30) 20/09/2005 US 60/719,069; 06/04/2006 US 60/790,417
(51) A47J 31/20 (2006.01), A47J 31/40 (2006.01)
(54) MÁQUINA PARA PREPARAR POR INFUSÃO UMA BEBIDA TAL COMO
CAFÉ E MÉTODO RELACIONADO
(57) MÁQUINA PARA PREPARAR POR INFUSÃO UMA BEBIDA TAL COMO
CAFE E MÉTODO RELACIONADO Uma modalidade de uma máquina para
preparar por infusão uma bebida como café inclui uma câmara e um conjunto
de pistão disposto na câmara. A câmara é operável para receber um líquido, tal
como água e uma base de sabor, tal como café moído e permitir que a bebida
seja preparada por infusão de uma mistura do líquido e base. O conjunto de
pistão é operável para filtrar um sólido como a base de café moído usado a
partir da bebida preparada por infusão pelo movimento em uma primeira
direção, e forçar a bebida filtrada para fora da câmara pelo movimento em uma
segunda direção. Por modificar ou automatizar algumas ou todas as etapas da
técnica de preparo por infusão de prensa francesa, tal máquina pode controlar
um ou mais dos parâmetros de preparo por infusão com um nível de precisão
que fornece café preparado por infusão tendo um sabor uniforme de xícara para
xícara. Além disso, tal máquina pode preparar o café por infusão com uma
velocidade que torna a máquina apropriada para uso por estabelecimentos que
servem quantidades significativas de café.
(71) COFFEE EQUIPMENT COMPANY (US)
(72) ZANDER NOSLER, RANDY HULETT, MICHAEL BAUM, IZAAK KOLLER,
BRIAN SHAY
(74) MONTAURY PIMENTA, MACHADO & LIOCE
(85) 19/03/2008
(86) PCT US2006/036844 de 20/09/2006
(87) WO 2007/035877 de 29/03/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 37
(21) PI 0616094-8 A2 (22) 07/09/2006
1.3
(30) 21/09/2005 US 11/232,193
(51) A61F 13/64 (2006.01)
(54) ARTIGO ABSORVENTE DESCARTÁVEL COM TIRAS DISTRIBUÍVEIS
(57) ARTIGO ABSORVENTE DESCARTÁVEL COM TIRAS DISTRIBUÍVEIS
Trata-se de um artigo absorvente descartável tendo braçadeiras de barreira
fixadas internamente, lateralmente opostas e ao menos uma tira distribuível.
Cada braçadeira de barreira é fixada a uma superfície interna de um conjunto
absorvente e tem um elemento elástico franzido fixado adjacente à sua borda
proximal. A tira tem uma extremidade fixa e uma primeira e uma segunda
bordas opostas conectando a extremidade fixa a uma extremidade livre oposta.
A tira é fixada à extremidade fixa e é distribuída dobrada lateralmente para fora
de forma que a primeira borda estende-se lateralmente para fora a partir de
uma extremidade de uma linha de dobra diagonal e a segunda borda estendese lateralmente para fora a partir da extremidade oposta da linha de dobra
diagonal. A tira pode ser unida à outra tira ou pode ser presa à região da cintura
do artigo ou a outra tira.
(71) THE PROCTER & GAMBLE COMPANY (US)
(72) Theodora Beck, Michael Patrick Hayden, Gary Dean Lavon, Kenneth
Michael Hamall, Susan Joy Ludwig
(74) Vieira de Mello Advogados
(85) 19/03/2008
(86) PCT IB2006/053162 de 07/09/2006
(87) WO 2007/034350 de 29/03/2007
(21) PI 0616096-4 A2 (22) 18/09/2006
1.3
(30) 20/09/2005 US 60/596376
(51) C07K 14/82 (2006.01), C12N 15/82 (2006.01), A01H 5/10 (2006.01)
(54) POLINUCLEOTÍDEO, VETOR, CÉLULA HOSPEDEIRA, MÉTODO PARA
A FABRICAÇÃO DE UM POLIPEPTÍDEO, POLIPEPTÍDEO, ANTICORPO,
ORGANISMO NÃO HUMANO TRANSGÊNICO, E, MÉTODOS PARA A
FABRICAÇÃO DE UM LIPÍDEO OU UM ÁCIDO GRAXO, E PARA A
FABRICAÇÃO DE UMA PLANTA TENDO UMA QUANTIDADE MODIFICADA
DE UM COMPOSTO DE ARMAZENAGEM DE SEMENTE
(57) POLINUCLEOTÍDEO, VETOR, CÉLULA HOSPEDEIRA, METODO PARA
A FABRICAÇÃO DE UM POLIPEPTÍDEO, POLIPEPTÍDEO, ANTICORPO,
ORGANISMO NÃO HUMANO TRANSGÊNICO, E, METODOS PARA A
FABRICAÇÃO DE UM LIPÍDEO OU UM ÁCIDO GRAXO, E PARA A
FABRICAÇÃO DE UMA PLANTA TENDO UMA QUANTIDADE MODIFICADA
DE UM COMPOSTO DE ARMAZENAGEM DE SEMENTE A presente invenção
diz respeito a seqúências de ácido nucleico semelhantes à resposta tripla
constitutiva (semelhante a CTR]) e as proteínas reguladoras do metabolismo de
açúcar e lipídeo codificadas pelas ditas seqúências de ácido nucleico. Além
disso, a presente invenção diz respeito ao uso das seqúências de ácido
nucleico já mencionadas e proteínas em plantas transgénicas. Em particular, a
invenção é direcionada a métodos para manipular compostos relacionados com
açúcar e para aumentar o nível de óleo e alterar a composição de ácido graxo
em plantas e sementes. A invenção ainda diz respeito a métodos de usar estes
novos polipeptideos vegetais para estimular o desenvolvimento vegetal e/ou
38
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
aumentar o rendimento e/ou composição de compostos de armazenagem de
semente.
(71) BASF PLANT SCIENCE GMBH (DE)
(72) Heiko A. Härtel, Jermaine Gibson, Jeffrey A. Brown
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/066465 de 18/09/2006
(87) WO 2007/039442 de 12/04/2007
(21) PI 0616097-2 A2 (22) 13/09/2006
1.3
(30) 20/09/2005 US 60/718.941
(51) G01F 1/84 (2006.01)
(54) ELETRÔNICA DE MEDIDOR E MÉTODOS PARA GERAR UM SINAL DE
ACIONAMENTO PARA UM FLUXÔMETRO VIBRATÓRIO
(57) ELETRÔNICA DE MEDIDOR E MÉTODOS PARA GERAR UM SINAL DE
ACIONAMENTO PARA UM FLUXÔMETRO VIBRATÓRIO Uma eletrônica de
medidor (20) para gerar um sinal e acionamento para um fluxômetro vibratório
(5) é fornecido de acordo com uma modalidade da invenção. A eletrônica de
medidor inclui uma interface (201) e um sistema de processamento (203) . O
sistema de processamento é configurado para receber o sinal de sensor (201)
através da interface, deslocar em fase o sinal de sensor (210) substancialmente
90 graus para criar um sinal de sensor deslocado em fase, determinar um valor
de deslocamento de fase de uma resposta de fregúência do fluxômetro
vibratório, e combinar o valor de deslocamento de fase com o sinal de sensor
(201) e o sinal de sensor deslocado em fase para gerar uma fase de sinal de
acionamento (213) . O sistema de processamento é também configurado para
determinar uma amplitude do sinal de sensor (214) do sinal de sensor (210) e
do sinal de sensor desloca- do em fase, e gerar uma amplitude do sinal de
acionamento (215) com base na amplitude do sinal de sensor (214), em que a
fase de sinal de acionamento (213) é substancialmente idêntica a uma fase de
sinal de sensor (212)
(71) MICRO MOTION, INC. (US)
(72) Timothy J. Cunningham, William M. Mansfield, Craig B. Mcanally
(74) Nellie Anne Daniel Shores
(85) 19/03/2008
(86) PCT US2006/035706 de 13/09/2006
(87) WO 2007/035376 de 29/03/2007
(21) PI 0616098-0 A2 (22) 29/08/2006
1.3
(30) 16/09/2005 DE 20 2005 014 688.9
(51) F02M 35/12 (2006.01), F02M 35/16 (2006.01), B60T 17/20 (2006.01)
(54) RESSONADOR
(57) RESSONADOR. À invenção cabe a tarefa de sugerir um ressonador (1),
bem como, um sistema de compressor de ar ressonador do condutor de aspiraçáo, com o qual o espaço de construção limitado na área da máquina de
combustão interna de um veículo automotor seja melhor aproveitado. A tarefa é
solucionada com um ressonador (1) ou com um sistema de compressor de ar
ressonador do condutor de aspiração, no qual a abertura de saída de ar (6a, 6b)
da câmara do ressonador (8) seja, ao mesmo tempo, uma abertura de
aspiração de um agregado adicional, em particular, de um compressor de ar
(7a, 7b).
(71) MANN+HUMMEL GMBH (DE)
(72) Gerhard Mayer, Torsten Fritzsching
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT EP2006/065768 de 29/08/2006
(87) WO 2007/031401 de 22/03/2007
(21) PI 0616099-9 A2 (22) 15/09/2006
1.3
(30) 21/09/2005 US 11/232.062; 11/09/2006 US 11/530.787
(51) A61C 5/02 (2006.01)
(54) COMPOSIÇÕES, KITS E MÉTODOS PARA INICIAR OU ACELERAR A
CURA DE COMPOSIÇÕES ENDODÔNTICAS OBTURADORAS OU
SELANTES COLOCADAS EM UM CANAL RADICULAR
(57) COMPOSIÇÕES, KITS E MÉTODOS PARA INICIAR OU ACELERAR A
CURA DE COMPOSIÇÕES ENDODÔNTICAS OBTURADORAS OU
SELANTES COLOCADAS EM UM CANAL RADICULAR Pontos endodônticos
de ativação (28a,28b) e/ou outros instrumentos dentais são dimensionados e
configurados para serem colocados no canal radicular (12) de um dente (10) .
Os pontos endodônticos de ativação (28a,28b) ou instrumentos dentais são
revestidos ou impregnados com um agente de cura que inicia ou acelera a
polimerização de uma composição selante ou obturadora (32) quando colocada
em contato com o material selante ou obturador (32) . Os agentes de cura
podem incluir aminas que possam desestabilizar um peróxido no material
selante ou obturador (32) para iniciar ou acelerar a polimerização, ou eles
podem compreender peróxido. Um implemento pode ser imerso numa
composição concentrada de cura logo antes da inserção do implemento dentro
de um canal radicular para contatar a composição selante ou obturadora. Kits
podem incluir uma pluralidade de composições de agentes de cura possuindo
diferentes concentrações e/ou quantidades do agente de cura. Os kits podem
também incluir um material resina curável que inclui uma primeira parte de um
sistema de cura multi-partes e uma composição de cura que inclui, como
agente de cura, uma parte complementar do sistema de cura.
(71) ULTRADENT PRODUCTS, INC (US)
(72) Richard D. Tuttle, Jeff A. Wagner, Jaleena Fischer-Jessop, Neil T. Jessop
(74) ALEXANDRE FERREIRA
(85) 20/03/2008
(86) PCT US2006/036298 de 15/09/2006
(87) WO 2007/038051 de 05/04/2007
(21) PI 0616100-6 A2 (22) 20/09/2006
1.3
RPI 2109 de 07/06/2011
(30) 22/09/2005 US 60/719.353; 17/10/2005 US 60/727.377
(51) A61K 31/4439 (2006.01), A61K 31/445 (2006.01), A61P 25/28 (2006.01)
(54) COMBINAÇÃO DE ROSIGLITAZONA E DONEPEZIL PARA
MELHORAMENTO DA FUNÇÃO COGNITIVA
(57) COMBINAÇAO DE ROSIGLITAZONA E DONEPEZIL PARA
MELHORAMENTO DA FUNÇAO COGNITIVA A invenção relaciona-se entre
outras coisas a uma composição farmacêutica compreendendo ambos,
rosiglitazona ou um sal farmaceuticamente aceitável do mesmo e donepezil ou
um sal farmaceuticamente aceitável do mesmo que é se uso no tratamento ou
profilaxia da doença de Alzheimer ou outras demências e deficiência cognitiva
moderada. A invenção tam- bém se relaciona a formas de dosagem orais
compreendendo rosiglitazona ou um sal farmaceuticamente aceitável do
mesmo e donepezil ou um sal farmaceuticamente aceitável do mesmo.
(71) SB Pharmco Puerto Rico Inc. (PR)
(72) ALLEN D. ROSES, JOANNE HEAFIELD, ANN M. SAUNDERS
(74) ALEXANDRE FERREIRA
(85) 20/03/2008
(86) PCT US2006/036597 de 20/09/2006
(87) WO 2007/038112 de 05/04/2007
(21) PI 0616101-4 A2 (22) 19/09/2006
1.3
(30) 22/09/2005 HU P0500877
(51) C07C 323/63 (2006.01), C07C 233/35 (2006.01), A61K 31/4965 (2006.01)
(54) DERIVADOS DE AMINO-ALQUIL-AMIDA COMO LIGANTES DE
RECEPTORES CCR3
(57) DERIVADOS DE AMINO-ALQUIL-AMIDA COMO LIGANTES DE
RECEPTORES CCR3. A presente invenção refere-se aos ligantes de
receptores CCR3 da fórmula geral (l), dentro deles favoravelmente aos
antagonistas, e aos seus sais, solvatos e isômeros, às composições
farmacêuticas que os contêm, ao uso dos compostos da fórmula geral (l) e de
seus sais, solvatos e isômeros, à preparação dos compostos da fórmula geral
(l) e de seus sais, solvatos e isômeros, e aos novos intermediários da fórmula
geral (III).
(71) SANOFI-AVENTIS (FR)
(72) Lajos T.Nagy, Péter Arányi, Sándor Bátori, Márton Varga, György
Ferenczy, Endre Mikus, Katalin Urbán-Szabó, Judit Vargáné Szeredi, Tibor
Szabó, Erzsébet Walcz, Ágnes Pappné Behr, Zoltán Kapui, Veronika Bartáné
Bodor
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT HU2006/000077 de 19/09/2006
(87) WO 2007/034251 de 29/03/2007
(21) PI 0616102-2 A2 (22) 26/09/2006
1.3
(30) 30/09/2005 SE 0502158-9
(51) G06Q 90/00 (2006.01)
(54) UM MÉTODO E UM SISTEMA PARA SUPORTE DE VENDAS DE
PRODUTO
(57) UM MÉTODO E UM SISTEMA PARA SUPORTE DE VENDAS DE
PRODUTO A presente invenção se refere a um método para suporte de vendas
de produto compreendendo: - uma primeira etapa de estabelecimento de
contato entre um cliente (2) e um distribuidor (3) para possibilitar ao cliente (2)
estabelecer uma encomenda para um produto; - uma segunda etapa (13) de
armazenamento de informação de encomenda relacionada para referido
produto em uma base de dados de sistema de vendas (10) estando associada
com referido distribuidor (3); - uma terceira etapa (16) de transferência de
referida informação de encomenda a partir de referido distribuidor (3) para um
manufaturador (4) de referido produto; e - uma quarta etapa (17) de
armazenamento de referida informação de encomenda em uma base de dados
de sistema de encomenda (11) do manufaturador (4). Em concordância com a
presente invenção, o referido método está caracterizado pelo fato de que
compreende as seguintes etapas adicionais:- provisão de acesso para referido
cliente (2) para referida base de dados de sistema de encomenda (11); e possibilitar ao referido cliente (2) realizar alterações de referida informação de
encomenda armazenada em referida base de dados de sistema (11) depois de
referida etapa de transferência (16)
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 39
(71) VOLVO LASTVAGNAR AB (SE)
(72) Mats Gustavsson, Benny Liljeblad
(74) MAGNUS ASPEBY E CLAUDIO SZABAS
(85) 20/03/2008
(86) PCT SE2006/001089 de 26/09/2006
(87) WO 2007/037741 de 05/04/2007
(21) PI 0616103-0 A2 (22) 20/09/2006
1.3
(30) 22/09/2005 IT FI2005 A 000197
(51) B65H 73/00 (2006.01)
(54) DISPOSITIVO PARA SEPARAR NÚCLEOS DE ENROLAMENTO DE
VOLTAS DE MATERIAL ENROLADO NAS APARAS DE BOBINAS DE
MATERIAL EM FAIXA
(57) DISPOSITIVO PARA SEPARAR NÚCLEOS DE ENROLAMENTO DE
VOLTAS DE MATERIAL ENROLADO NAS APARAS DE BOBINAS DE
MATERIAL EM FAIXA. A presente invenção refere-se a dispositivo que
compreende um membro móvel (5), ao redor do qual são posicionados
elementos de engate (9) para axialmente engatar as aparas (R). O membro
móvel alimenta os elementos de engate continuamente ao longo de um
percurso fechado, ao longo do qual um dispositivo (20) é provido para
desprender as voltas do material em faixa dos núcleos tubulares.
(71) FABIO PERINI S.P.A. (IT)
(72) NICCOLÒ BRIGHELLA, GIOVANNI BRIGHELLA, MAURO GELLI, VANNI
BRIGHELLA
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT IT2006/000668 de 20/09/2006
(87) WO 2007/034528 de 29/03/2007
(21) PI 0616104-9 A2 (22) 05/09/2006
1.3
(30) 23/09/2005 FR 0552830
(51) B64D 27/20 (2006.01), B64C 27/02 (2006.01), B64C 5/06 (2006.01)
(54) TURBO-REATOR PARA AERONAVE, AERONAVE MUNIDA DESSE
TURBO-REATOR E PROCESSO DE MONTAGEM DESSE TURBO-REATOR
SOBRE UMA AERONAVE
(57) TURBO-REATOR PARA AERONAVE, AERONAVE MUNIDA DESSE
TURBO REATOR E PROCESSO DE MONTAGEM DESSE TURBO-REATOR
SOBRE UMA AERONAVE A invenção se refere a um turbo-reator (1) para a
aeronave, caracterizado pelo fato de suportar pelo menos uma deriva (7), essa
deriva sendo fixada sobre a estrutura forte (11) desse turbo-reator, de maneira
a formar um conjunto monobloco. O turbo-reator pode também suportar um ou
vários dos dispositivos anexos necessários ao funcionamento desse turboreator. A invenção se refere também a uma aeronave munida desse turboreator, e um processo de montagem desse turbo-reator sobre a aeronave.
(71) AIRBUS FRANCE (FR)
(72) BERNARD GUERING, OLIVIER TEULOU
(74) ORLANDO DE SOUZA
(85) 20/03/2008
(86) PCT FR2006/050841 de 05/09/2006
(87) WO 2007/034094 de 29/03/2007
(21) PI 0616105-7 A2 (22) 22/09/2006
1.3
40
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(30) 22/09/2005 US 60/719,424; 18/01/2006 US 60/759,944; 13/02/2006 US
60/772,812
(51) A61F 2/44 (2006.01)
(54) DISCO INTERVERTEBRAL ARTIFICIAL
(57) DISCO INVERTEBRAL ARTIFICIAL A presente invenção é direcionada à
área de dispositivos protéticos. Mais particularmente, uma representação da
presente invenção destina-se a um disco artificial que pode ser usado na
substituição de um disco invertebral (por exemplo, um disco lombar invertebral
humano, um disco cervical invertebreal humano ou um disco torácico invertebral
humano.
(71) Blackstone Medical, Inc (US)
(72) ALAN LOMBARDO, MARK SEMLER, JOSEPH F. FERRARO, THEODORE
KARWOSKI, THOMAS M. SWANICK, BRIAN C. SUNTER
(74) Mirian Oliveira da Rocha Pitta
(85) 20/03/2008
(86) PCT US2006/037097 de 22/09/2006
(87) WO 2007/038337 de 05/04/2007
(21) PI 0616106-5 A2 (22) 18/09/2006
1.3
(30) 23/09/2005 US 60/720.010
(51) B65D 71/00 (2006.01)
(54) CARTOLINA PARA CONTER UMA PLURALIDADE DE ARTIGOS, E
MATRIZ PARA FORMAÇÃO DE UMA CARTOLINA
(57) CARTOLINA PARA CONTER UMA PLURALIDADE DE ARTIGOS, E
MATRIZ PARA FORMAÇÃO DE UMA CARTOLINA Trata-se de uma
embalagem (5) para contenção de uma pluralidade de artigos (C) . A
embalagem tem painéis que se estendem pelo menos parcialmente em torno de
um interior da embalagem. Os painéis compreendem um painel de topo (10),
um painel de fundo (30) e um primeiro painel lateral (20) e um segundo painel
lateral (40) . A embalagem possui um dispositivo de fornecimento (7) para
permitir acesso aos artigos que se encontram na embalagem. O dispositivo de
fornecimento possui um painel de dispositivo de fornecimento (67) que é pelo
menos parcialmente definido por uma linha de ruptura (89) na embalagem e se
destina a ser pelo menos parcialmente removido para abrir pelo menos
adicionalmente uma abertura de dispositivo de fornecimento. A embalagem
pode igualmente ter uma extremidade curva (53)
(71) GRAPHIC PACKAGING INTERNATIONAL, INC (US)
(72) Jean-Manuel Gomes, Raymond Rudolph Spivey
(74) Walter de Almeida Martins
(85) 20/03/2008
(86) PCT US2006/036175 de 18/09/2006
(87) WO 2007/038038 de 05/04/2007
RPI 2109 de 07/06/2011
(30) 22/09/2005 EP 05 020718.2
(51) C07K 14/605 (2006.01), C07K 19/00 (2006.01)
(54) PEPTÍDEOS DE FUSÃO GLP-1, SUA PRODUÇÃO E USO
(57) PEPTÍDEOS DE FUSÃO GLP-1, SUA PRODUÇÃO E USO. A presente
invenção refere-se a peptídeos de fusão possuindo atividade GLP-1 e
estabilidade melhorada in vivo, especificamente resistência à dipeptidil
peptidase IV. O peptídeo de fusão compreende, como componente (1) uma
sequência GLP-1 (7-35, 7-36 ou 7-37) de término N e como componente (II)
uma sequência peptídica de término O de pelo menos 9 a- minoácidos ou um
fragmento funcional, variante ou derivado do mesmo. O componente (II) é
preferivelmente uma versão plena ou parcial de lP2 (peptídeo de intervenção 2).
Uma concretização preferida compreende a se- qúência GLP-1 (7-35, 36 ou
37)IIP2IGLP-1(7-35, 36 ou 37) ou GLP-2. O peptídeo de fusão pode ser
produzido em células transformadas ou sinteticamente e pode ser usado para a
preparação de um medicamento para tra- tamento de várias doenças ou
distúrbios, por exemplo, diabetes do tipo 1 ou 2, doenças relacionadas à
apoptose ou distúrbios neurodegenerativos.
(71) BIOCOMPATIBLES UK LTD. (GB)
(72) PETER GEIGLE, CHRISTINE WALLRAPP, ERIC THOENES
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT EP2006/009226 de 22/09/2006
(87) WO 2007/039140 de 12/04/2007
(21) PI 0616108-1 A2 (22) 13/09/2006
1.3
(30) 23/09/2005 US 60/719,793
(51) A61K 9/20 (2006.01), A61K 31/44 (2006.01), A61K 31/455 (2006.01), A61K
31/4427 (2006.01)
(54) FORMULAÇÃO DE DOSAGEM
(57) FORMULAÇÃO DE DOSAGEM. A invenção refere-se a um processo para
preparação de uma omposição farmacêutica em comprimido, em que o
ingrediente farmacêuti- o ativo de fórmula l em que as definições são descritas
na reivindicação 1 ou sais de adição ácidos farmaceuticamente aceitáveis
destes, e um polo- âmero solúvel em água são processados juntos por extrusão
de fusão uente antes da mistura com os outros ingredientes, e em que a
composição em comprimido pode, em seguida, ser revestida com uma
composição compreendendo um sistema de revestimento de película de
liberação imediata e gua purificada. A invenção refere-se também a
composições farmacêuticas, reparadas por tal método.
(71) F Hoffmann-La Roche AG (CH)
(72) Hashim A. Ahmed, Susanne Page, Navnit Hargovindas Shah
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT EP2006/066310 de 13/09/2006
(87) WO 2007/039420 de 12/04/2007
(21) PI 0616109-0 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 EP 05 020657.2
(51) G01D 5/241 (2006.01), G01D 5/20 (2006.01)
(54) DISPOSITIVO E MÉTODO PARA DETERMINAÇÃO DE POSIÇÃO
ABSOLUTA SEM CONTATO
(57) DISPOSITIVO E MÉTODO PARA DETERMINAÇÃO DE POSIÇÃO
ABSOLUTA SEM CONTATO. A presente invenção refere-se a uma disposição
sem contato para determinar uma posição absoluta de um membro adaptado
para ajustar uma quantidade de medicamento a ser injetada de um dispositivo
de dispensa de medicação, ou adaptado para determinar uma quantidade de
medicamento injetada de um dispositivo de dispensa de medicação. A
disposição, de acordo com a presente invenção, compreende pelo menos uma
trilha de meio refletor, pelo menos um meio emissor, e pelo menos um meio
receptor. Pelo menos um meio emissor e pelo menos um meio receptor são
adaptados para serem eletricamente acoplados a inúmeros meios refletores. O
acoplamento elétrico pode ser capacitivo ou indutivo. Além disso, a presente
invenção refere-se a um dispositivo de dispensa de medicação ou a uma
seringa apresentando tal disposição.
(71) NOVO NORDISK A/S (DK)
(72) PREBEN NIELSEN, BODO VON MÜNCHOW
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT EP2006/009240 de 22/09/2006
(87) WO 2007/039148 de 12/04/2007
(21) PI 0616107-3 A2 (22) 22/09/2006
1.3
RPI 2109 de 07/06/2011
(21) PI 0616110-3 A2 (22) 22/09/2006
1.3
(30) 23/09/2005 DE 10 2005 045 780.0
(51) C23F 17/00 (2006.01)
(54) PROCESSO PARA PRODUÇÃO DE UM PRODUTO DE AÇO PLANO
PROTEGIDO CONTRA CORROSÃO
(57) PROCESSO PARA PRODUÇÃO DE UM PRODUTO DE AÇO PLANO
PROTEGIDO CONTRA CORROSÃO. A presente invenção refere-se a
produção de chapas de aço protegidas contra corrosão com boas propriedades
de uso para determinadas finalidades de aplicação. Para essa finalidade, em
um processo para produção de produtos planos de aço protegidos contra
corrosão, - sobre um produto plano de aço é aplicada por deposição eletrolítica
uma camada de cobertura contendo zinco, - o produto plano de aço se
necessário é finamente limpo mecanicamente e/ou quimicamente,- diretamente
sobre a camada de cobertura contendo zinco, limpa, por meio de uma
deposição de fase de vapor é aplicada uma segunda camada de cobertura à
base de magnésio, e - após a aplicação da segunda camada de cobertura, sob
atmosfera normal é executado um acabamento térmico do produto plano de aço
revestido para formação de uma camada de difusão ou de convecção entre a
camada de cobertura contendo zinco e à base de magnésio a uma temperatura
de tra- tamento que importa em 320ºC até 335ºC.
(71) THYSSENKRUPP STEEL AG (DE)
(72) NICOLE WEIHER, BERND SCHUMACHER, MICHAEL STEINHORST,
ANDREAS KLARE, TAMARA APPEL, RALF BAUSE, STEFAN KÖHLER,
KRASIMIR NIKOLOV, MONIKA RIEMER, SLAVCHO TOPALSKI, ROLF BODE,
FRANK FRIEDEL, WILFRIED PRANGE, REINHARD SCHULZKI, CHRISTIAN
SCHWERDT
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT EP2006/066632 de 22/09/2006
(87) WO 2007/033992 de 29/03/2007
(21) PI 0616111-1 A2 (22) 01/09/2006
1.3
(30) 21/09/2005 US 60/719,467; 21/09/2005 US 60/719,468; 21/09/2005 US
60/719,477
(51) C07D 207/12 (2006.01), C07D 413/12 (2006.01), C07D 211/46 (2006.01),
C07D 205/04 (2006.01), A61K 31/397 (2006.01), A61K 31/40 (2006.01), A61K
31/4409 (2006.01), A61P 37/00 (2006.01)
(54) COMPOSTO DE CARBOXAMIDA, SEU USO, COMBINAÇÕES E
INTERMEDIÁRIOS
(57) COMPOSTO DE CARBOXAMIDA, SEU USO, COMBINAÇÕES E
INTERMEDIÁRIOS. A invenção refere-se a compostos da fómula processos e
intermediários para a sua preparação, seu uso como antagonistas muscarínicos
e composição farmacêutica contendo-os.
(71) PFIZER LIMITED (GB)
(72) Paul Alan Glossop, Simon John Mantell, Ross Sinclair Strang, Christine
Anne Louise Watson, Anthony Wood
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT IB2006/002727 de 01/09/2006
(87) WO 2007/034325 de 29/03/2007
(21) PI 0616113-8 A2 (22) 08/09/2006
1.3
(30) 23/09/2005 IT PD2005A000275
(51) E05D 15/30 (2006.01)
(54) MECANISMO PARA A INSTALAÇÃO DE UMA PORTA OU OUTRO
FECHAMENTO SEMELHANTE, E, PORTA COM UM MOVIMENTO
DESLIZANTE ROTATIVO
(57) MECANISMO PARA A INSTALAÇÃO DE UMA PORTA OU OUTRO
FECHAMENTO SEMELHANTE, E, PORTA COM UM MOVIMENTO
DESLIZANTE ROTATIVO Um mecanismo para a instalação de uma porta ou
outro fechamento semelhante tendo um movimento deslizante rotativo, do tipo
incluindo os seguintes elementos para associar a um obturador ou algo assim: primeiros dispositivos de pivô definindo um primeiro eixo vertical (11) para o
pivotamento do obturador (12), em uma região substancialmente central da
mesma, para transíação de dispositivos colocados de forma a deslizarem um
guia correspondente (13) associado a escora superior (14) da estrutura (15) da
porta; - segundos dispositivos de pivô com um eixo paralelo ao eixo do primeiro
dispositivo de pivô, para o pivotamento dos dois braços (16 e 17) um primeiro
superior (16) e um segundo inferior (17), que são ambos pivotados com uma de
suas extremidades (21, 22) para a estrutura (15) do fechamento em
proximidade a um umbral (18) para definir um segundo eixo de rotação (20), e
ter as extremidades opostas (23, 24) recíproca e rigidamente acopladas pelos
dispositivos de uma haste (25), definindo um terceiro eixo de rotação (26)
interposto entre o primeiro eixo (11) e o segundo eixo (20), passando através do
obturador (12) na direção da altura da mesma. Os segundos dispositivos de
pivotamento são rigidamente acoplados à estrutura (15) com dispositivos para
ajustar a distância do segundo eixo de rotação (20) a partir de perto do umbral
(18) da porta ou semelhante; adicionalmente a haste (25) é fixada a pelo menos
um dos dois braços (16, 17) por um dispositivo rígido de conexão (27) que
fornecer uma junção não soldada entre a haste (25) e os braços (16, 17). Tais
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 41
mecanismos, adequadamente com a invenção facilitam e melhoram a
instalação de portas tendo um movimento deslizante rotativo.
(71) SANDRA RIGO (IT)
(72) SANDRO SACCON
(74) Momsen, Leonardos & CIA.
(85) 20/03/2008
(86) PCT EP2006/006177 de 08/09/2006
(87) WO 2007/039401 de 12/04/2007
(21) PI 0616114-6 A2 (22) 26/09/2006
1.3
(30) 27/09/2005 FR 05 52900
(51) B64D 27/18 (2006.01), B64D 29/02 (2006.01)
(54) DISPOSITIVO DE AFIXAÇÃO DE UM MOTOR DESTINADO A SER
INTERPOSTO ENTRE UM AEROFÓLIO DE AERONAVE E O REFERIDO
MOTOR E CONJUNTO MOTOR
(57) DISPOSITIVO DE AFIXAÇÃO DE UM MOTOR DESTINADO A SER
INTERPOSTO ENTRE UM AEROFÓLIO DE AERONAVE E O REFERIDO
MOTOR E CONJUNTO MOTOR A presente invenção se refere a um dispositivo
de afixação de um motor destinado a ser interposto entre um aerofólio de
aeronave e este motor, o dispositivo comportando uma estrutura rígida (8),
assim como, uma estrutura aerodinâmica frontal (24) montada fixamente sobre
a referida estrutura (8) pelo intermédio de meios de afixação, a estrutura
aerodinâmica frontal sendo destinada a trazer tampas de insuflação e a ser
interposta entre a estrutura rígida e o aerofólio. De acordo com a invenção, os
meios de afixação compreendem pelo menos uma biela de comprimento
regulável (32) na qual uma extremidade é montada sobre a estrutura (8), e cuja
outra extremidade é montada sobre a estrutura aerodinâmica frontal (24).
(71) AIRBUS FRANCE (FR)
(72) STÉPHANE COMBES, LAURENT LAFONT
(74) Momsen, Leonardos & CIA.
(85) 20/03/2008
(86) PCT EP2006/066736 de 26/09/2006
(87) WO 2007/036519 de 05/04/2007
(21) PI 0616115-4 A2 (22) 26/09/2006
1.3
(30) 28/09/2005 FR 0552930
(51) B64D 33/10 (2006.01), F02C 7/14 (2006.01)
(54) CONJUNTO MOTOR PARA AERONAVE, E, AERONAVE
(57) CONJUNTO MOTOR PARA AERONAVE, E, AERONAVE A invenção se
refere a um conjunto motor (1) para aeronave que compreende um motor e um
estribo de afixação (4) do motor, o conjunto comportando igualmente um
sistema de troca térmica (104) que dispõe de uma segunda saída (1 22a)
situada entre a caixa e o motor, atrás em relação à conexão motor traseira (8).
42
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
Além disso, o trocador (114) do sistema de troca térmica (104) está disposto,
pelo menos parcialmente, no interior de uma carenagem aerodinâmica traseira
(66) do estribo de afixação (4), esta carenagem aerodinâmica traseira (66)
estando situada inteiramente atrás em relação à referida conexão motor traseira
(8).
(71) AIRBUS FRANCE (FR)
(72) FRÉDÉRIC JOURNADE, ROBERT BRUNET
(74) Momsen, Leonardos & CIA.
(85) 20/03/2008
(86) PCT EP2006/066742 de 26/09/2006
(87) WO 2007/036523 de 05/04/2007
(21) PI 0616116-2 A2 (22) 27/09/2006
1.3
(30) 29/09/2005 FR 05/52952
(51) B29C 73/04 (2006.01), B29C 73/32 (2006.01), B32B 43/00 (2006.01), B32B
3/12 (2006.01), B64F 5/00 (2006.01), H01Q 1/42 (2006.01)
(54) PROCESSO DE REPARAÇÃO ATRAVESSANTE DE UMA ESTRUTURA
DE MATERIAL COMPÓSITO
(57) PROCESSO DE REPARAÇÃO ATRAVESSANTE DE UMA ESTRUTURA
DE MATERIAL COMIPÓSITO As porções de reparação (6, 20, 21, 22 e 23),
estabelecidas através de duas camadas de alma (16, 19), por exemplo, em
colméia e três películas (2, 3, 17) de polímero, na qual duas películas externas
e uma película mediana intercalada entre as camadas de alma para dar uma
estrutura compósita, são instaladas e o polímero é endurecido a vácuo. Uma
contra- forma (8) é apoiada sobre uma das películas (2) para garantir um bom
aspecto e uma boa qualidade de superficie. De acordo com a invenção,
aberturas de ventilação (24) são previstas através da película mediana (21) e
eventualmente através da película (2) que recebe a contra-forma para uma boa
liberação de ar da alma alveolar subjacente (20).
(71) AIRBUS FRANCE (FR)
(72) JEAN-CLAUDE MARTY, JACQUES FOURNIE, CHRISTOPHE BERNUS
(74) Momsen, Leonardos & CIA.
(85) 20/03/2008
(86) PCT EP2006/066811 de 27/09/2006
(87) WO 2007/036545 de 05/04/2007
(21) PI 0616117-0 A2 (22) 29/08/2006
1.3
(30) 01/09/2005 US 60/713,543; 21/08/2006 US 11/507,313
(51) F16F 5/00 (2006.01)
(54) BUCHA HIDRÁULICO
(57) BUCHA HIDRAULICO. Uma montagem de bucha hidráulica inclui um tubo
interior, uma bucha elastomérica disposto ao redor do tubo interior, uma
inserção disposta em torno do buchaelastomérica e um tubo externo disposto
em torno da inserção, O bucha elastomérica e a inserção definem um par de
câmaras que são ligadas por uma passagem definida pela inserção. Um par de
tubos intermediários são dispostos no bucha elastomérica em extremidades
opostas axiais da inserção.
(71) THE PULLMAN COMPANY (US)
(72) JAY THORNHILL, ROBERT GOUDIE, RICHARD BUTCH BROWN, MARK
MORMAN, BILL BURK, HAROLD HENRY, DANIEL WITTLER, ROBERT
FERGUSON, DAVID STEWART, ANDREW FRANZEN, DAVID BAKER
(74) Di Blasi, Parente, S. G. & Associados
RPI 2109 de 07/06/2011
(85) 03/03/2008
(86) PCT US2006/033728 de 29/08/2006
(87) WO 2007/027695 de 08/03/2007
(21) PI 0616118-9 A2 (22) 30/08/2006
1.3
(30) 01/09/2005 US 60/713,246
(51) A61K 38/21 (2006.01), A61K 31/56 (2006.01), A61K 38/35 (2006.01), A61P
25/00 (2006.01)
(54) TRATAMENTO DE NEURITE ÓTICA
(57) TRATAMENTO DE NEURITE ÓTICA. A presente invenção refere-se a um
método para tratamento de um paciente tendo desmielinação de neurite ótica
(DON) compreendendo ta administração seqúencial ou simultânea de um
composto de esteróide e um interferonbeta proteína. Verificou-se que
precocemente, o tratamento agressivo de IFN-b é benéfico em tal regime de
tratamento, por exemplo onde o interteronbeta proteína é administrado em uma
dose semanal cumulativa de mais do que 12 MIU. O método de acordo com a
invenção é particular- mente adequado e benéfico para tratamento de pacientes
tendo DON de estágio precoce. Em particular, a DON que se beneficiará de ser
tratada de acordo com a presente invenção pode estar em um estágio
subclínico.
(71) ARES TRADING S.A. (CH)
(72) ROBERT SERGOTT
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT EP2006/065830 de 30/08/2006
(87) WO 2007/025991 de 08/03/2007
(21) PI 0616119-7 A2 (22) 10/08/2006
1.3
(30) 01/09/2005 US 11/218,213
(51) C08F 10/00 (2006.01), C08F 4/646 (2006.01), C08F 210/16 (2006.01)
(54) COMPOSIÇÕES CATALÍTICAS QUE COMPREENDEM MATERIAIS DE
SUPORTE TENDO UMA MELHOR DISTRIBUIÇÃO DE TAMANHO DE
PARTÍCULA
(57) COMPOSIÇÕES CATALÍTICAS QUE COMPREENDEM MATERIAIS DE
SUPORTE TENDO UMA MELHOR DISTRIBUIÇÃO DE TAMANHO DE
PARTÍCULA. A invenção refere-se uma composição catalítica que inclui um
material de suporte com uma melhor distribuição de tamanho de partícula.
Processos para produzir uma composição poliolefínica também são fornecidos.
Polímeros e filmes também são fornecidos. Um exemplo de uma com- posição
catalítica é uma composição de múltiplos catalisadores de metais de transição
sobre um suporte, incluindo: (a) pelo menos dois componentes catalisadores
selecionados do grupo que consiste em: um componente ca- talisador nãometaloceno e um componente catalisador de metaloceno; (b) um material de
suporte que tem uma D50 menor do que cerca de 30 mícrons e uma distribuição
de tamanho de particula com uma relação D90/D10 menor do que cerca de 6; e
(c) um ativador.
(71) UNIVATION TECHNOLOGIES, LLC (US)
(72) Chi-I Kuo, Dongming Li, Porter C. Shannon, Tae Hoon Kwalk
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT US2006/031273 de 10/08/2006
(87) WO 2007/030260 de 15/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616120-0 A2 (22) 01/09/2006
1.3
(30) 02/09/2005 US 60/713,328
(51) C12N 15/31 (2006.01), A61K 39/09 (2006.01), A61K 38/16 (2006.01), A61P
31/00 (2006.01), C07K 14/315 (2006.01), C07K 16/12 (2006.01), C07K 7/08
(2006.01), C12N 15/74 (2006.01), G01N 33/569 (2006.01)
(54) POLIPEPTÍDEOS DE STREPTOCOCCUS SUIS E POLINUCLEOTÍDEOS
CODIFICANDO OS MESMOS E SEU USO EM APLICAÇÕES DE VACINA E
DIAGNÓSTICO
(57) POLIPEPTÍDEOS DE STREPTOCOCCUS SUIS E POLINUCLEOTÍDEOS
CODIFICANDO OS MESMOS E SEU USO EM APLICAÇÕES DE VACINA E
DIAGNÓSTICO. A presente invenção refere-se ao campo de Streptococcus.
Mais especificamente, a presente invenção refere-se à identificação de
polípeptídeos e sequências de polinucleotideo codificando os mesmos que
estão envolvidos no mecanismo patogénico de S. suis. A presente invenção
refere-se também ao uso de tais polipeptídeos em composições e métodos para
a prevenção, o tratamento e diagnóstico de doenças associadas com S. suis e
infecções causadas por S. suis.
(71) UNIVERSITÉ DE MONTRÉAL (CA)
(72) MARCELO GOTTSCHALK, YUANYI LI, JOSEE HAREL
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT CA2006/001454 de 01/09/2006
(87) WO 2007/025390 de 08/03/2007
(21) PI 0616121-9 A2 (22) 01/09/2006
1.3
(30) 02/09/2005 JP 2005-255657
(51) F16L 15/04 (2006.01), C10M 103/06 (2006.01), C10M 169/02 (2006.01),
C25D 5/26 (2006.01), C25D 7/00 (2006.01), C10N 10/12 (2006.01), C10N 40/00
(2006.01), C10N 50/08 (2006.01), C10N 50/10 (2006.01)
(54) JUNTA ROSCADA PARA TUBOS DE AÇO
(57) JUNTA ROSCADA PARA TUBOS DE AÇO. A presente invenção refere-se
a uma junta roscada para tubos de aço consistindo de um pino 1 e uma caixa 2,
cada qual tendo uma porção roscada (1a, 2a) e uma porção de contacto de
metal não roscada (lb, 2b) exibe adequada resistência ao vazamento e
resistência a escoriações quan- do usada para composição de artigos tubulares
de campo petrolífero com aplicação de um dope verde ou mesmo sem qualquer
dope. A junta roscada possui uma primeira camada de galvanização, de
galvanização de liga de Sn-Bi ou galvanização de ligas de Sn-Bi-Cu, formada
na superfície de contacto de pelo menos um de pino 1 e caixa 2. A primeira
camada de galvanização pode ter uma segunda camada de galvanização
selecionada das galvanização de Sn, galvanização de Cu e galvanização de Ni
no seu lado inferior e pelo menos uma camada de um revestimento lubrificante
e,particularmente, um revestimento lubrificante sólido, no seu lado superior.
(71) SUMITOMO METAL INDUSTRIES LTD. (JP) , VALLOUREC
MANNESMANN OIL & GAS FRANCE (FR)
(72) SHIGEO NAGASAKU, SHIGEO ONISHI, HIROAKI IKEGAMI, KUNIO
GOTO
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT JP2006/317802 de 01/09/2006
(87) WO 2007/026970 de 08/03/2007
(21) PI 0616122-7 A2 (22) 06/09/2006
1.3
(30) 09/09/2005 US 60/716,013; 24/01/2006 US 60/762,070; 06/09/2006 US
60/824,651
(51) A01L 3/00 (2006.01)
(54) COBERTURA PARA CASCO COM PRENDEDOR DE CALCANHAR
PIVOTANTE
(57) COBERTURA PARA CASCO COM PRENDEDOR DE CALCANHAR
PIVOTANTE .A presente invenção refere-se a uma cobertura para casco que
apresenta uma base, um prendedor de calcanhar e um mecanismo de pivotamento que dispõe o prendedor de calcanhar para pivotar com relação à base,
preferivelmente de maneira a permitir ao prendedor de calcanhar pelo menos
três graus de liberdade de movimento com relação à base. O prendedor de
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 43
calcanhar é preferivelmente baixo na porção mais traseira, o que proporciona
um afastamento para que os ossos da quartela da parte inferior da perna do
cavalo sejam abaixados sobre o peso que é sustentado durante o movimento
em vários passos. Para reduzir a possibilidade de contusão e esfoladura do
tecido mole em torno dos ossos da quartela, e para ajudar a eliminar o acúmulo
de detritos, prendedores de calcanhar preferidos apresentam uma arquitetura
de malha aberta. Os prendedores de calcanhar podem ser alternativa ou
adicionalmente projetados com neopreno coberto de tecido ou outros
revestimentos. Coberturas são preferivelmente apertadas usando cadarços
mecanicamente vantajosos.
(71) KIRT LANDER (US)
(72) KIRT LANDER
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 10/03/2008
(86) PCT US2006/034653 de 06/09/2006
(87) WO 2007/030497 de 15/03/2007
(21) PI 0616123-5 A2 (22) 11/09/2006
1.3
(30) 09/09/2005 US 60/715,781
(51) H02M 5/458 (2006.01), H02M 7/49 (2007.01), H02M 1/12 (2006.01)
(54) SISTEMA E MÉTODO PARA REDUZIR EFEITOS HARMÔNICOS EM UM
SISTEMA DE DISTRIBUIÇÃO DE ENERGIA
(57) SISTEMA E MÉTODO PARA REDUZIR EFEITOS HARMÔNICOS EM UM
SISTEMA DE DISTRIBUIÇÃO DE ENERGIA. A presente invenção refere-se a
um sistema de distribuição de energia, e um método para operá-lo que inclui
uma pluralidade de células de energia que são conectadas a uma máquina de
múltiplos enrolamentos com- preendendo um ou mais enrolamentos primários e
uma pluralidade de enrolamentos secundários de tal forma que cada célula seja
eletricamente conectada a um dos enrolamentos secundários e uma pluralidade
dos enrolamen- tos secundários são defasados em relação aos enrolamentos
primários, em que cada célula inclui uma pluralidade de dispositivos de
chaveamento. O método inclui determinar para cada célula em um conjunto de
células de energia, um ângulo de deslocamento de portador, e sincronizar, para
cada célula no conjunto, um sinal portador à voltagem secundária para a célula
baseado no ângulo de deslocamento de portador determinado para a célula. O
sinal portador para cada célula controla a regulação de operação dos dispositivos de chaveamento dentro da célula.
(71) SIEMENS ENERGY AND AUTOMATION, INC (US)
(72) RICHARD OSMAN, JOHN CHANNING BOUSFIELD III
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 10/03/2008
(86) PCT US2006/035602 de 11/09/2006
(87) WO 2007/030833 de 15/03/2007
(21) PI 0616124-3 A2 (22) 01/09/2006
1.3
44
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(30) 02/09/2005 EP 05 108070.3
(51) C07F 7/18 (2006.01)
(54) COMPOSIÇÃO DE ORGANO-ALCOXISSILANO ESTABILIZADA COM
TENSOATIVO
(57) COMPOSIÇÃO DE ORGANO-ALCOXISSILANO ESTABILIZADA COM
TENSOATIVO. A presente invenção refere-se a composições de Organoalcoxissilanos contendo pelo menos um Organo-alcoxissilano S, bem como pelo
menos um tensoativo anidro T, sendo que a fração em peso de todos os
Organo-alcoxissilanos S perfaz 33% em peso, em relação ao peso da
composição de Organo-alcoxissilano e sendo que a proporção da soma do
peso de todos os Organo-alcoxissilanos S para a soma do peso de todos os
tensoativos anidros T (S:T) apresenta um valor de 5:1 até 1:2.
(71) SIKA TECHNOLOGY AG (SE)
(72) Jolanda Sutter, Wolf-Rüdiger Huck
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT EP2006/065915 de 01/09/2006
(87) WO 2007/026015 de 08/03/2007
(21) PI 0616125-1 A2 (22) 11/09/2006
1.3
(30) 09/09/2005 DE 10 2005 043 179.8
(51) B60R 13/02 (2006.01)
(54) PEÇA DE REVESTIMENTO DECORADA
(57) PEÇA DE REVESTIMENTO DECORADA. A presente invenção refere-se a
uma peça de revestimento para o interior de um automóvel, consistindo em um
substrato e uma folha unida com o mesmo, em que a folha consiste em
polipropileno (PP) ou em um co-polímero de polipropileno.
(71) JOHNSON CONTROLS INTERIORS GMBH & CO. KG (DE) , NORDENIA
DEUTSCHLAND GRONAU GMBH (DE)
(72) SREENIVAS PARUCHURI, STEPHAN WOLF, PAUL ANGENHEISTER,
VASSILLOS MANIATOPOULOS, PATRICK GEURTS, LEONIDAS KIRIAZIS
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 10/03/2008
(86) PCT EP2006/008829 de 11/09/2006
(87) WO 2007/028651 de 15/03/2007
(21) PI 0616126-0 A2 (22) 28/08/2006
1.3
(30) 02/09/2005 US 60/713.343
(51) A61K 45/06 (2006.01), A61K 47/00 (2006.01), A61K 47/26 (2006.01), A61K
47/34 (2006.01), A61K 47/44 (2006.01), A61K 9/48 (2006.01), A61K 31/4745
(2006.01), A61K 31/566 (2006.01), A61K 31/137 (2006.01), A61P 31/00
(2006.01)
(54) FORMULAÇÃO E MÉTODO PARA INTENSIFICAÇÃO DA ABSORÇÃO
GASTRINTESTINAL DE AGENTES FARMACÊUTICOS
(57) FORMULAÇAO E MÉTODO PARA INTENSIFICAÇAO DA ABSORÇÃO
GASTRINTESTINAL DE AGENTES FARMACÊUTICOS A presente invenção se
refere a um método de intensificação da absorção de um agente farmacêutico
por administração do agente em combinação com um inibidor de
BCRP/ABCG2, sendo a quantidade do inibidor aproximadamente igual à
concentração crítica micelarda micela critica do inibidor ou inferior à
concentração micelarda micela critica- crítica. A invenção também se refere a
uma formulação ade- quada para uso para intensificar a absorção de um agente
farmacêutico. O agente farmacêutico pode ser um agente quimioterápico. A
invenção também se refere a cápsulas contendo a formulação.
(71) WARNER-LAMBERT COMPANY LLC (US)
(72) YUICHI SUGIYAMA, MARIKO MORISHITA, HASSAN BENAMEUR,
ROLAND DAUMESNIL
(74) ALEXANDRE FERREIRA
(85) 03/03/2008
(86) PCT US2006/033423 de 28/08/2006
(87) WO 2007/027560 de 08/03/2007
(21) PI 0616127-8 A2 (22) 28/08/2006
1.3
(30) 01/09/2005 US 60/713,403
(51) A61K 9/08 (2006.01), A61K 31/47 (2006.01), A61K 47/12 (2006.01)
(54) FORMULAÇÃO DE ARGATROBAN
(57) FORMULAÇÃO DE ARGATROBAN. A presente invenção refere-se a uma
composição farmacêutica aquosa, estéril estável do inibidor da trombina
argatroban em uma solução contendo um ácido para solubilizar o argatroban,
substancialmente livre de álcool desidratado, bem como método para sua
preparação.
(71) BAXTER INTERNATIONAL INC (US) , BAXTER HEALTHCARE SA. (CH)
(72) George Owoo, Richard A. Burgos
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT US2006/033432 de 28/08/2006
(87) WO 2007/027565 de 08/03/2007
(21) PI 0616129-4 A2 (22) 30/08/2006
1.3
(30) 02/09/2005 US 11/219,186
(51) C22F 1/04 (2006.01)
(54) PROCESSO DE EXTRUSÃO DE UM PRODUTO DE LIGA DE ALUMÍNIO
6020 TEMPERADA SOB PRESSÃO
(57) PROCESSO DE EXTRUSÃO DE UM PRODUTO DE LIGA DE ALUMINIO
6020 TEMPERADA SOB PRESSÃO. A presente invenção refere-se a um
processo de produção de um produto de liga de alumínio 6020 temperada sob
pressão, compreenden- do as etapas de: proporcionar um lingote ou tarugo de
uma liga de alumínio 6020, consistindo essencialmente em cerca de 0,5 a cerca
de 0,6% de silicio, cerca de 0,7 a cerca de 0,8% de magnésio, cerca de 0,55 a
cerca de 0,65% de cobre, cerca de 0,35 a cerca de 0,45% de ferro, cerca de
RPI 2109 de 07/06/2011
0,01 a cerca de 0,04% de manganês, cerca de 1,05 a cerca de 1,15% de
estanho, cerca de 0,04 a cerca de 0,06% de cromo; homogeneizar o tarugo;
resfriar o tarugo; reaquecer o tarugo; extrudar o tarugo; temperar o produto
extrudado; e envelhecer artificialmente o produto extrudado. A liga teve
produtividade, resistência mecânica e trabalhabilidade otimizados e pode ser
usada como um substituto direto para a liga contendo chumbo 6262-T6.
(71) ALCOA INC (US)
(72) DAVID A.LUKASAK, THOMAS J. KLEMP
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 03/03/2008
(86) PCT US2006/033561 de 30/08/2006
(87) WO 2007/027629 de 08/03/2007
(21) PI 0616132-4 A2 (22) 20/09/2006
1.3
(30) 20/09/2005 EP 05255804.6
(51) C10L 1/22 (2006.01), C10L 1/18 (2006.01), C10L 1/14 (2006.01), C10L
10/00 (2006.01), C10L 1/222 (2006.01), C10L 1/224 (2006.01), C10L 1/198
(2006.01), C10L 1/2383 (2006.01), C10L 10/18 (2006.01)
(54) COMPOSIÇÃO DE COMBUSTÍVEL, MÉTODO DE OPERAÇÃO DE UM
MOTOR DE COMBUSTÃO INTERNA, E, USO DE UMA COMPOSIÇÃO DE
COMBUSTÍVEL
(57) COMPOSIÇÃO DE COMBUSTÍVEL, METODO DE OPERAÇÃO DE UM
MOTOR DE COMBUSTÃO INTERNA, E, USO DE UMA COMPOSIÇÃO DE
COMBUSTÍVEL A invenção fornece uma composição de combustível que
compreende uma grande quantidade de um combustível para um motor de
combustão interna e uma pequena quantidade de um dendrímero compatível
com o combustível contendo de 4 a 64 grupos funcionais terminais
independentemente selecionados de grupos de amino, hidroxila e carboxilato; e
o uso de tais composições como combustível em um motor de combustão
interna para controle dos depósitos na câmara de combustão.
(71) SHELL INTERNATIONALE RESEARCH MAATSCHAPPIJ B.V. (NL)
(72) George Robert Lee
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/066525 de 20/09/2006
(87) WO 2007/039457 de 12/04/2007
(21) PI 0616135-9 A2 (22) 22/09/2006
1.3
(30) 23/09/2005 GB 0519462.6
(51) B31B 5/26 (2006.01), A41D 31/02 (2006.01), A61F 13/00 (2006.01)
(54) PANO ABSORVENTE DE UMIDADE PARA UM PEÇA DE VESTUÁRIO, E,
PEÇA DE VESTUÁRIO FORMADA DE UM PANO ABSORVENTE DE
UMIDADE
(57) PANO ABSORVENTE DE UMIDADE PARA UMA PEÇA DE VESTUARIO,
E, PEÇA DE VESTUÁRIO FORMADA DE UM PANO ABSORVENTE DE
UMIDADE Um pano absorvente de umidade tem um lado compreendido
substancialmente inteiramente, de fibras inerentemente hidrofóbieas, tais como
poliéster ou polipropileno, e o outro lado compreendido de uma mistura de
fibras hidrofóbicas, tais como poliéster ou polipropileno, e fibras hidrofilicas,
particularmente fibras celulósicas tais como algodão, lyocell e rayon de viscose.
Uma peça de vestuário pode ser formada deste pano absorvente de umidade,
por exemplo, pelo método de tricotar peça de vestuário inteira, o lado
compreendido de mistura de fibras sendo o lado externo da peça de vestuário.
(71) LENZING AKTIENGESELLSCHAFT (AT)
(72) THOMAS RICHARD BURROW, HIENRICH FIRGO
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT GB2006/003534 de 22/09/2006
(87) WO 2007/034204 de 29/03/2007
(21) PI 0616136-7 A2 (22) 19/09/2006
1.3
(30) 21/09/2005 US 60/719275; 21/09/2005 US 60/719286
(51) C07D 215/52 (2006.01), A61K 31/47 (2006.01), A61K 31/4709 (2006.01),
A61P 11/00 (2006.01), A61P 25/00 (2006.01), C07D 401/12 (2006.01)
(54) COMPOSTO, PROCESSO PARA PREPARAR O MESMO, MÉTODO DE
TRATAMENTO OU PROFILAXIA DE UMA DOENÇA OU CONDIÇÃO,
COMPOSIÇÃO FARMACÊUTICA, E, USO DE UM COMPOSTO
(57) COMPOSTO, PROCESSO PARA PREPARAR O MESMO, METODO DE
TRATAMENTO OU PROFILAXIA DE UMA DOENÇA OU CONDIÇÃO,
COMPOSIÇÃO FARMACÊUTICA, E, USO DE UM COMPOSTO Os compostos
RPI 2109 de 07/06/2011
1
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 45
2
3
4
5
da fórmula em que R , A, R , R , R , R , n, m e q são como descritos no
relatório descritivo, sais farmaceuticamente aceitáveis, métodos de fabricar,
composições farmacêuticas que os contenham e métodos para usar os
mesmos.
(71) ASTRAZENECA AB (SE)
(72) JEFFREY S. ALBERT, GERARD M. KOETHER, CRISTOBAL ALHAMBRA,
JAMES KANG, JAMES WOODS, YAN LI, THOMAS R. SIMPSON
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT SE2006/001068 de 19/09/2006
(87) WO 2007/035158 de 29/03/2007
(21) PI 0616137-5 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 JP 2005-275487
(51) A61K 31/194 (2006.01), A61K 31/225 (2006.01), A61K 31/341 (2006.01),
A61K 31/351 (2006.01), A61K 31/4164 (2006.01), A61K 31/4406 (2006.01),
A61K 31/445 (2006.01), A61K 31/4453 (2006.01), A61K 31/495 (2006.01),
A61K 31/5375 (2006.01), A61K 45/00 (2006.01), A61P 31/04 (2006.01), A61P
43/00 (2006.01), C07C 57/145 (2006.01), C07C 57/26 (2006.01), C07C 57/42
(2006.01), C07C 57/48 (2006.01), C07C 57/50 (2006.01), C07C 59/42
(2006.01), C07C 59/46 (2006.01)
(54)
INIBIDOR
DA
METALO-ß-LACTAMASE,
COMPOSIÇÃO
FARMACÊUTICA, PROCESSO PARA TRATAR INFECÇÕES BACTERIANAS,
COMPOSTO, E, USO DO MESMO
(57)
INIBIDOR
DA
METALO-ß-LACTAMASE,
COMPOSIÇÃO
FARMACÊUTICA, PROCESSO PARA TRATAR INFECÇÕES BACTERIANAS,
COMPOSTO, E, USO DO MESMO É descrito um inibidor da metalo-ßlactamase, que pode inativar um antibiótico de ßlactama e recuperar a atividade
anti-bacteriana do antibiótico de ß-lactama. Um derivativo do ácido maleico,
tendo uma estrutura de fórmula geral (l) tem uma atividade inibitória contra
metalo-ß-lactamase. O uso do composto (l), em combinação com um antibiótico
de ß-lactama, possibilita a recuperação da atividade anti-bacteriana do
antibiótico de ß-lactama, contra uma bactéria capaz de produzir metalo-ßlactamase.
(71) Meiji Seika Kaisha LTD (JP)
(72) KEN CHIKAUCHI, MIZUYO IDA, TAKAO ABE, YUKIKO HIRAIWA,
AKIHIRO MORINAKA, TOSHIAKI KUDO
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT JP2006/318879 de 22/09/2006
(87) WO 2007/034924 de 29/03/2007
(21) PI 0616138-3 A2 (22) 22/09/2006
1.3
(30) 26/09/2005 FR 05 52868
(51) B64D 27/26 (2006.01)
(54) PROCESSO DE MONTAGEM DE UM MOTOR DE AERONAVE EM UMA
ESTRUTURA RÍGIDA DE UM ESTRIBO DE AFIXAÇÃO DO MOTOR
(57) PROCESSO DE MONTAGEM DE UM MOTOR DE AERONAVE EM UMA
ESTRUTURA RIGIDA DE UM ESTRIBO DE AFIXAÇÃO DO MOTOR A
invenção se refere a um processo de montagem de um motor de aeronave em
uma estrutura rígida de um que compreende uma etapa de fixação, na
estrutura, de um corpo de fixação (46) de uma fixação de motor, esse corpo de
fixação sendo destinado a ser aplicado contra uma superficie de contato da
estrutura rígida orientada para a frente, e fixado nessa estrutura por intermédio
de pelo menos um pião de cisalhamento (68) que atravessa um primeiro e um
segundo orificio primário, a etapa de fixação compreendendo as operações
seguintes: - pré-posicionamento do motor em relação ao estribo com o objetivo
de colocar o primeiro orificio em frente ao segundo orificio; e - introdução de um
eixo equipado com uma cabeça recurvada de centragem através dos dois
orificios, de modo que esse eixo constitua o pião de cisalhamento.
(71) AIRBUS FRANCE (FR)
(72) LAURENT LAFONT, FRÉDÉRIC JOURNADE, ERIC RENAUD
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/066633 de 22/09/2006
(87) WO 2007/033993 de 29/03/2007
(21) PI 0616139-1 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 US 60/719,171; 28/09/2005 US 60/721,129
(51) G06F 19/00 (2011.01), C12Q 1/68 (2006.01), C07K 14/05 (2006.01)
(54) MÉTODO PARA AVALIAR O RISCO DE METÁSTASE À DISTÂNCIA,
MICROESTRUTURA DE ÁCIDO NUCLÉICO ÚTIL NA DETERMINAÇÃO DO
RISCO DE METÁSTASE À DISTÂNCIA E COLEÇÃO EM MEIO OU KIT
(57) METODO PARA AVALIAR O RISCO DE METÁSTASE A DISTANCIA,
MICROESTRUTURA DE ÁCIDO NUCLÉICO ÚTIL NA DETETERMINAÇAO DO
RISCO DE METÁSTASE À DISTANCIA E COLEÇAO EM MEIO OU KIT A
presente invenção revela que a definição do perfil de transcrito de mRNA pode
ser utilizada para formular preditores moleculares de metástase à distância,
para NPC's primários, Os resultados previstos são altamente correlacionados
com sobrevivência geral e livre de metástase curta. As predições são feitas
usando preditores baseados em 52 genes e preditores baseados em 12 genes.
(71) CHINA SYNTHETIC RUBBER CORPORATION (US)
(72) KUO-JANG KAO, ANDREW HUANG
(74) Claudia Christina Schulz
(85) 19/03/2008
(86) PCT US2006/037203 de 22/09/2006
(87) WO 2007/038402 de 05/04/2007
(21) PI 0616141-3 A2 (22) 11/09/2006
1.3
(30) 22/09/2005 US 60/719.521
(51) C07D 233/54 (2006.01), C07D 401/04 (2006.01), C07D 403/04 (2006.01),
C07D 403/10 (2006.01), C07D 403/12 (2006.01), C07D 401/12 (2006.01), C07D
405/12 (2006.01), C07D 405/06 (2006.01), C07D 401/06 (2006.01), C07D
409/12 (2006.01), C07D 413/12 (2006.01), C07D 487/04 (2006.01), C07D
487/08 (2006.01), A61K 31/4178 (2006.01)
(54) COMPOSTOS IMIDAZOL PARA O TRATAMENTO DE DISTÚRBIOS
NEUROLÓGICOS
(57) COMPOSTOS IMIDAZOL PARA O TRATAMENTO DE DISTÚRBIOS
NEUROLÓGICOS A presente invenção está relacionada a compostos de
Fórmula (I) onde R1, R2, R3, R4, R6, R7 e A são como definidos. Os compostos
de Fórmula (I) possuem atividade de inibição da produção de Aß-peptídeo. A
invenção também está relacionada a composições farmacêuticas e métodos
para tratar doenças e distúrbios, por exemplo, distúrbios neurodegenerativos
e/ou neurológicos, por exemplo, doença de Alzheimer, em um mamífero
compreendendo os compostos de Fórmula (I)
(71) PFIZER PRODUCTS INC. (US)
(72) MICHAEL AARON BRODNEY, YUHPYNG LIANG CHEN, KAREN JEAN
COFFMAN, EDWARD FOX KLEINMAN, BRIAN THOMAS O´NEILL
(74) NELLIE ANNE DANIEL SHORES
(85) 19/03/2008
(86) PCT IB2006/002753 de 11/09/2006
(87) WO 2007/034326 de 29/03/2007
46
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0616142-1 A2 (22) 22/09/2006
1.3
(30) 26/09/2005 FR 0552869
(51) B64C 27/26 (2006.01)
(54) CONJUNTO MOTOR PARA AERONAVE
(57) CONJUNTO MOTOR PARA AERONAVE A invenção se refere a um
conjunto motor (1) para aeronave que compreende um motor (6) e um
dispositivo de afixação (4) do motor, o dispositivo de afixação sendo destinado
a ser interposto entre um acrofólio da aeronave e o motor, e comportando uma
estrutura rígida (8) assim como meios de afixação do motor (6) sobre a referida
estrutura rígida, os meios de afixação sendo constituídos de uma primeira
conexão (10) assim como uma segunda conexão (12). De acordo com a
invenção, a primeira conexão comporta duas semiconexões laterais (1Oa) cada
uma fixada sobre um cárter de insuflação (18) do motor, e a segunda conexão é
fixada sobre uma parte frontal de um cárter central (22) deste motor.
(71) AIRBUS FRANCE (FR)
(72) Lionel Diochon, Raffaella Mastroberti, Isabelle Petrissans
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/066635 de 22/09/2006
(87) WO 2007/033994 de 29/03/2007
(21) PI 0616143-0 A2 (22) 26/09/2006
1.3
(30) 28/09/2005 FR 05/52934
(51) B64D 27/26 (2006.01)
(54) ESTRIBO DE AFIXAÇÃO DE MOTOR PARA UMA AERONAVE E
PROCESSO DE FABRICAÇÃO DO MESMO
(57) ESTRIBO DE AFIXAÇÃO DE MOTOR PARA UMA AERONAVE E
ROCESSO DE FABRICAÇÃO DO MESMO Uma nova estrutura de estribo de
afixação do conjunto motor de uma aeronave é descrita. O estribo (50)
compreende uma armação monolítica (20), fabricada por fundição ou soldagem,
por exemplo, revestida de películas (40) montadas mecanicamente.
Vantajosamente, reforços (30) estão solidarizados, mecanicamente, aos pontos
de esforço (26). A estrutura dual (20, 40) de acordo com a invenção permite
tirar vantagem da integração durante a fabricação respeitando, ao mesmo
tempo, os critérios de segurança graças às montagens mecânicas.
(71) AIRBUS FRANCE (FR)
(72) LAURENT LAFONT
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/066731 de 26/09/2006
(87) WO 2007/036516 de 05/04/2007
RPI 2109 de 07/06/2011
(21) PI 0616145-6 A2 (22) 29/08/2006
1.3
(30) 22/09/2005 EP 05108750.0
(51) C08G 18/76 (2006.01), C07C 263/10 (2006.01), C07C 263/20 (2006.01),
C08G 18/02 (2006.01)
(54) POLIISOCIANATOS, PROCESSO PARA A PREPARAÇÃO DE UM
POLIISOCIANATO, VARIANTES DE POLIISOCIANATO E PRÉ-POLÍMEROS,
E, PROCESSO PARA A PRODUÇÃO DE ESPUMAS DE POLIURETANO
(57) POLIISOCIANATOS, PROCESSO PARA A PREPARAÇÃO DE UM
POLIISOCIANATO, VARIANTES DE POLIISOCIANATO E PRE- POLÍMEROS,
E, PROCESSO PARA A PRODUÇÃO DE ESPUMAS DE POLIURETANO
Processo para a preparação de poliisocianatos envolvendo a remoção de uma
corrente de solvente enriquecida com contaminantes não isocianato contendo
grupo volátil, aromático a partir do processo de produção de poliisocianato.
(71) HUNTSMAN INTERNATIONAL LLC (US)
(72) Robert Henry Carr, Johannes Lodewijk Koole, Peter Muller
(74) Momsen, Leonardos & CIA.
(85) 19/03/2008
(86) PCT EP2006/065786 de 29/08/2006
(87) WO 2007/039362 de 12/04/2007
(21) PI 0616146-4 A2 (22) 19/09/2006
1.3
(30) 22/09/2005 US 60/719,516; 08/09/2006 US 11/518,132
(51) C07D 417/04 (2006.01), C07D 417/08 (2006.01), C07D 417/12 (2006.01),
C07D 277/64 (2006.01), C07D 487/04 (2006.01), A61K 31/428 (2006.01), A61K
51/04 (2006.01), A61P 9/10 (2006.01)
(54) DERIVADOS BENZOTIAZOL CICLOBUTIL AMINA E SEU USO COMO
LIGANTES DOS RECEPTORES DE HISTAMINA-3
(57) DERIVADOS BENZOTIAZOL CICLOBUTIL AMINA E SEU USO COMO
LIGANTES DOS RECEPTORES DE HISTAMINA-3 Compostos de fórmula (I)
são úteis no tratamento de condições ou distúrbios evitados ou melhorados
pelos ligantes do receptor de histamina-3. Também são revelados composições
farmacêuticas compreendendo os ligantes do receptor de histamina-3, métodos
para uso desses compostos e composições, e um processo para preparar os
compostos inseridos no escopo da fórmula (I)
(71) ABBOTT LABORATORIES (US)
(72) Marlon D. Cowart, Minghua Sun, Chen Zhao, Guo Zhu Zheng
(74) Nellie Anne Daniel Shores
(85) 19/03/2008
(86) PCT US2006/036422 de 19/09/2006
(87) WO 2007/038074 de 05/04/2007
(21) PI 0616148-0 A2 (22) 07/09/2006
1.3
(30) 21/09/2005 US 11/231,500
(51) A61F 13/64 (2006.01)
(54) ARTIGO ABSORVENTE DESCARTÁVEL COM TIRAS DISTRIBUÍVEIS
(57) ARTIGO ABSORVENTE DESCARTÁVEL COM TIRAS DISTRIBUÍVEIS
Um artigo absorvente descartável com abas laterais internas opostas e pelo
menos uma tira distribuivel. Cada aba lateral é formada pela dobra de uma
parte do conjunto absorvente lateralmente para dentro e possui um elemento
elástico franzido fixado longitudinalmente adjacente à sua borda proximal. A tira
possui uma parte da extremidade fixa e primeira e segunda bordas opostas
conectando a parte da extremidade fixa a uma parte da extremidade livre
oposta. A tira é fixada à parte da extremidade fixa e é distribuída dobrada
lateralmente para fora de forma que a primeira borda estende-se lateralmente
para fora de um ponto da extremidade de uma linha de dobra diagonal e a
segunda borda estende-se lateralmente para fora do ponto da extremidade
oposta da linha de dobra diagonal. A tira pode ser unida à outra tira ou pode ser
apertada na região da cintura do artigo ou outra tira.
(71) THE PROCTER & GAMBLE COMPANY (US)
(72) GARY DEAN LAVON, KENNETH MICHAEL HAMALL, THEODORA BECK,
SUSAN JOY LUDWIG, MICHAEL PATRICK HAYDEN
(74) Vieira de Mello Advogados
(85) 19/03/2008
(86) PCT IB2006/053161 de 07/09/2006
(87) WO 2007/034349 de 29/03/2007
RPI 2109 de 07/06/2011
(21) PI 0616149-9 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 DE 20 2005 015 036.3
(51) B66C 1/34 (2006.01)
(54) GANCHO DE SUSPENSÃO DE CARGA COM UMA TRELIÇA
(57) GANCHO DE SUSPENSÃO DE CARGA COM UMA TRELIÇA. A presente
invenção refere-se a um gancho de suspensão de carga (1,11) para suspensão
de uma carga a ser movimentada. O gancho de suspensão de carga provê a
movimentação de cargas com meios simples e, apesar de uma alta capacidade
de carga, possui um peso reduzido em comparação com os ganchos
conhecidos. Isso é obtido pelo fato de que é formado ao menos por segmentos
por uma treliça, cujas escoras (2g, 2h, 13d-13f) estão dispostas e
dimensionadas em função das solicitações atuando localmente na carga
suspensa nos ganchos de suspensão de carga (1,11).
(71) SPANSET INTER AG (CH)
(72) STEFFEN SCHWANBECK
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT EP2006/066618 de 22/09/2006
(87) WO 2007/033986 de 29/03/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 47
(21) PI 0616151-0 A2 (22) 15/09/2006
1.3
(30) 21/09/2005 GB 05 19171.3
(51) A61Q 15/00 (2006.01), A61Q 19/00 (2006.01), A61K 8/365 (2006.01),
A61K 8/37 (2006.01), A61K 8/36 (2006.01), G01N 33/497 (2006.01), C07C
51/12 (2006.01)
(54) COMPOSTOS ORGÂNICOS
(57) COMPOSTOS ORGÂNICOS. Composição de sabor ou fragrância que
contém ácidos 3-hidróxi -4-metilalcanóicos, ácido 4-metilalqu-3-enóico e/ou
seus ésteres de fórmula (I) em que R1, R2 e R3 têm o mesmo significado como
determinado na descrição, é descrita.
(71) GIVAUDAN SA (CH)
(72) Samuel Derrer, Andreas Natsch
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT CH2006/000502 de 15/09/2006
(87) WO 2007/033508 de 29/03/2007
(21) PI 0616152-9 A2 (22) 21/09/2006
1.3
(30) 22/09/2005 JP 2005-276100
(51) A61K 36/48 (2006.01), A61P 1/16 (2006.01)
(54) USO DE GOMA SOLÚVEL EM ÁGUA OBTIDA A PARTIR DO CAULE
E/OU RAMO DA ESPÉCIE ACÁCIA
(57) USO DE GOMA SOLÚVEL EM ÁGUA OBTIDA A PARTIR DO CAULE
E/OU RAMO DA ESPÉCIE ACÁCIA. A presente invenção refere-se a um
intensificador para colineste- rase. Um intensificador compreendendo Goma
Arábica como um ingrediente ativo é útil para prevenir e/ou tratar uma atividade
de colinesterase diminuída devido ao dano do fígado, ou inibição de
colinesterase como um efeito colateral de vários agentes.
(71) Veritron Limited (GB)
(72) HIDEAKI MATSUDA, YOSHIMASA MIYAKE, NORIKO HIRATA
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT JP2006/319219 de 21/09/2006
(87) WO 2007/034982 de 29/03/2007
(21) PI 0616150-2 A2 (22) 19/09/2006
1.3
(30) 22/09/2005 HU P0500878; 15/09/2006 HU P0600726
(51) C07C 233/35 (2006.01), A61K 31/4965 (2006.01)
(54)
DERIVADOS
DE
AMINO-ALQUIL-AMIDA
COMO
LÍQUIDOS
RECEPTORES DE CCR3
(57)
DERIVADOS
DE
AMINO-ALQUIL-AMIDA
COMO
LÍQUIDOS
RECEPTORES DE CCR3. A presente invenção refere-se a ligantes de
receptores CCR3 da fórmula geral (I) no interior da mesma favoravelmente a
antagonistas e aos sais, solvatos e isômeros destes, às composições
farmacêuticas contendo os mesmos, ao uso dos compostos da fórmula geral (I)
e seus sais, solvatos e isômeros, à preparação dos compostos da fórmula geral
(I) e seus sais, solvatos e isá- meros, e aos novos intermediários da fórmula
geral (lla).
(71) SANOFI-AVENTIS (FR)
(72) Lajos T. Nagy (falecido), Ágnes Pappné Behr, Sándor Bátori, Veronika
Bartáné Bodor, Márton Varga, György Ferenczy, Endre Mikus, Judit Vargáné
Szeredi, Erzsébet Walcz, Edit Susán, Zoltán Kapui, Péter Arányi, Katalin UrbánSzabó
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT HU2006/000078 de 19/09/2006
(87) WO 2007/034252 de 29/03/2007
(21) PI 0616154-5 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 GB 05 19290.1
(51) A61K 9/10 (2006.01), A61K 47/36 (2006.01)
(54) VEÍCULO ORAL, EMBALAGEM BLISTER PARA INCLUIR O REFERIDO
VEÍCULO, MÉTODO PARA FABRICAR UM BOLO DE GEL SEMISSÓLIDO
(BSSG), KIT DE MATÉRIAS-PRIMAS, MÉTODO PARA DISTRIBUIR UM BSSG
E USO DO MESMO
(57) 'VEÍCULO ORAL, EMBALAGEM BLISTER PARA INCLUIR O REFERIDO
VEÍCULO, MÉTODO PARA FABRICAR UM BOLO DE GEL SEMISSOLIDO
(BSSG), KIT DE MATÉRIAS-PRIMAS, MÉTODO PARA DISTRIBUIR UM BSSG
E USO DO MESMO. A presente invenção refere-se a um meio de distribuição
sistêmica de fármaco que compreende bolos de gel ágar semissólido, sendo
que cada um contém ingredientes ativos, separadamente embalados ou em
conjuntos de cooperação em embalagens blister, ou soltos em um recipiente.
Quando colocado na boca, o bolo é rompido, se desintegra, e libera os
ingrediente ativos. Sialogogos, sabores, e outros aditivos ajudam na deglutição.
Os grãos dos ingredientes ativos podem ser encapsulados dentro de cápsulas
de gel mais duras. Os ingredientes ativos incluem medicações de venda livre e
medicações
controladas.
As
aplicações
incluem
automedicação,
particularmente, em situações sem água disponivel, tais como, em transporte
público, medicação para crianças, vítimas de acidente vascular cerebral ou os
idosos.
(71) PBL MANUFACTURING LIMITED (NZ)
(72) CARL ERNEST ALEXANDER
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT NZ2006/000246 de 22/09/2006
(87) WO 2007/035117 de 29/03/2007
48
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
composto de Fórmula ou solvatos ou sais farmaceuticamente aceitáveis dos
mesmos, métodos para sua preparação, métodos para seu uso, e formulações
farmacêuticas compreendendo-os.
(71) PFIZER PRODUCTS INC. (US)
(72) BRIAN DOUGLAS PATTERSON, SYLVIE KIM SAKATA, MITCHELL DAID
NAMBU, LEENA BHARAT KUMAR PATEL, JOHN HOWARD TATLOCK
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT IB2006/002639 de 11/09/2006
(87) WO 2007/034312 de 29/03/2007
(21) PI 0616155-3 A2 (22) 13/09/2006
1.3
(30) 21/09/2005 US 11/231,554
(51) A61M 16/00 (2006.01)
(54) SISTEMA E MÉTODO DE ADMINISTRAÇÃO DE UM GÁS
FARMACÊUTICO A UM PACIENTE
(57) SISTEMA E MÉTODO DE ADMINISTRAÇÃO DE UM GÁS
FARMACÊUTICO A UM PACIENTE. A presente invenção refere-se a um
método e sistema para o envio de um gás farmacêutico a um paciente. O
método e sistema propor- cionam uma quantidade desejada de um gás
farmacêutico a um paciente independente do padrão respiratório do paciente.
Os gases farmacêuticos preferidos são CO e NO, ambos os quais são
proporcionados como uma concentração em um gás veículo. O sistema de
controle de gás determina o envio de um gás farmacêutico ao paciente para
resultar na quantidade desejada conhecida (por exemplo, em moléculas,
miligramas ou outras unidades quantificadas) do gás farmacêutico sendo
enviado. Com a conclusão da re- ferida quantidade desejada conhecida de gás
farmacêutico em uma plurali- dade de respirações, o sistema pode ou terminar
qualquer envio adicional de gás farmacêutico ou pode ativar um alarme para
alertar ao usuário de que a quantidade conhecida foi enviada. O sistema é
também dotado de funções de alarme para alertar o usuário de possíveis maus
funcionamentos do sistema.
(71) INO THERAPEUTICS LLC (US)
(72) FREDERICK J. MONTGOMERY, DUNCAN P.L. BATHE
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 20/03/2008
(86) PCT US2006/035450 de 13/09/2006
(87) WO 2007/037975 de 05/04/2007
(21) PI 0616156-1 A2 (22) 11/09/2006
1.3
(30) 23/09/2005 US 60/720,151; 03/10/2005 US 60/723,115; 11/10/2005 US
60725,469; 25/01/2006 US 60/762,256; 07/08/2006 US 60/821,664
(51) C07D 213/76 (2006.01), A61K 31/4406 (2006.01), A61P 39/00 (2006.01)
(54) COMPOSTOS TERAPÊUTICOS, COMPOSIÇÃO FARMACÊUTICA
COMPREENDENDO OS MESMOS E USO
(57) COMPOSTOS TERAPEUTICOS, COMPOSIÇÃO FARMACEUTICA
COMPREENDENDO OS MESMOS E USO. A presente invenção refere-se ao
(21) PI 0616157-0 A2 (22) 21/09/2006
1.3
(30) 21/09/2005 JP 2005-274748; 20/09/2006 JP 2006-255105
(51) H04N 5/44 (2011.01), H04B 1/16 (2006.01), H04H 1/00 (2008.01), H04N
7/173 (2011.01)
(54) RECEPTOR DE RADIOFUSÃO DIGITAL
(57) RECEPTOR DE RADIODIFUSÃO DIGITAL. A presente invenção refere-se
a um receptor de radiodifusão di- gital capaz de realizar a leitura de canal em
um tempo relativamente curto. O receptor de radiodifusão digital é projetado
para a instalação em um automó- vel, por exemplo, e identificar um local atual
que usa a função GPS. O recep- tor apresenta uma listagem de canais por
região contendo a informação de canal físico de estações de radiodifusão que
potencialmente existem em ca- da região, e realiza a leitura de canal com base
em dados de radiodifusão obtidos dos meios de recebimento para canais físicos
relacionados na lista- gem de canais em uma região identificada.
(71) SANYO ELECTRIC CO. LTD (JP)
(72) KAZUHIRO IEDA
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT JP2006/318785 de 21/09/2006
(87) WO 2007/034899 de 29/03/2007
(21) PI 0616158-8 A2 (22) 19/09/2006
1.3
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 49
(30) 19/09/2005 US 60/718,684
(51) C12N 15/11 (2006.01), A61K 31/712 (2006.01)
(54) MODULAÇÃO DE EXPRESSÃO DE RECEPTOR DE GLUCAGON
(57) MODULAÇÃO DE EXPRESSÃO DE RECEPTOR DE GLUCAGON.
Compostos, composições e métodos são providos para modula- ção da
expressão de receptor de glucagon. As composições compreendem compostos
de anti-sentido, particularmente oligonucleotídeos de anti-sentido que têm
propriedades particulares in vivo, objetivados para ácidos nuclélcos que
codificam receptor de glucagon. Métodos de uso destes compostos para
modulação de expressão de receptor de glucagon e para tratamento de doenças são providos.
(71) JOHNSON & JOHNSON PHARMACEUTICAL RESEARCH &
DEVELOPMENT, L.L.C. (US)
(72) BRETT P. MONIA, SUSAN M. FREIER, SANJAY BHANOT
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT US2006/036545 de 19/09/2006
(87) WO 2007/035771 de 29/03/2007
(21) PI 0616159-6 A2 (22) 15/09/2006
1.3
(30) 22/09/2005 JP 2005-276036
(51) D21F 3/02 (2006.01), D21F 7/08 (2006.01)
(54) CORREIA PARA PRENSA DE SAPATA
(57) CORREIA PARA PRENSA DE SAPATA. A presente invenção refere-se a
uma correia (10) para prensa de sapata compreendendo uma camada do lado
de sapata (20) um substrato (30) formado sobre a circunferência externa da
camada do lado de sapata (20), e uma camada do lado de papel úmido (60)
formada sobre a circunfe- rência externa do substrato (30). O substrato (30)
consiste em um material em treliça (40) formado por ligar a interseção de um fio
de urdume (40A) e de um fio de trama (40B), e uma camada de enrolamento de
fio (50) formada por enrolar um fio (50A) em espiral. A ligação na interseção de
fio de urdume (40A) e de fio de trama (40B) é separada facilmente e fricção se
processa entre eles, porém uma vez que o fio de urdume (40A) é levado a se
desgas- tar mais cedo que o fio de trama (40B), o fio de trama (40B) não se
desgasta no estágio anterior quando comparado com a técnica anteriormente
existen- te. Consequentemente, a resistência e a estabilidade dimensional da
correia para a prensa do tipo prensa de sapata são aumentadas.
(71) ICHIKAWA CO., LTD. (JP)
(72) Atsushi Ishino
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT JP2006/318804 de 15/09/2006
(87) WO 2007/034904 de 29/03/2007
(21) PI 0616160-0 A2 (22) 22/09/2006
1.3
(30) 22/09/2005 US 60/719,881
(51) A61M 5/178 (2006.01)
(54) ESTRUTURA DE RETRAÇÃO DE AGULHA
(57) ESTRUTURA DE RETRAÇÃO DE AGULHA. A presente invenção referese a um dispositivo de agulha de segurança que tem um alojamento alongado e
um conjunto de agulha móvel dentro do alojamento alongado. Uma estrutura de
retração está provida para mover o conjunto de agulha de uma posição
estendida em relação ao aloja- mento alongado para uma posição retraida
dentro do alojamento alongado. Um membro de bloqueio está provido para
imobilizar a estrutura de retração antes da utilização, O membro de bloqueio é
inserível entre a estrutura de retração e o alojamento alongado e/ou o conjunto
de agulha associados.
(71) TYCO HEALTHCARE GROUP L.P. (US)
(72) SCOTT JONES, GEORGE CLARK
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT US2006/037062 de 22/09/2006
(87) WO 2007/038318 de 05/04/2007
(21) PI 0616161-8 A2 (22) 21/09/2006
1.3
(30) 21/09/2005 JP 2005-273289
(51) G01G 19/387 (2006.01)
(54) APARELHO DE COMBINAÇÃO DE PESAGEM
(57) APARELHO DE COMBINAÇÃO DE PESAGEM. A presente invenção
refere-se aparelho de combinação de pe- sagem (1), que inclui uma unidade de
dispersão (2), uma pluralidade de ali- mentadores de pesagem (Xl a Xn), e uma
unidade de controle (20). A uni- dade de dispersão (2) dispersa
circunferencialmente artigos (M) que caem desde cima. Os alimentadores de
pesagem (Xl a Xn) são geralmente dis- postos circunferencialmente abaixo da
unidade de dispersão (2). A unidade de controle (20) combina os resultados de
peso obtidos de cada um dos ali- mentadores de pesagem (Vi (1 = 1, 2, ---, n)).
Adicionalmente, um estado de uma posição de queda dos artigos (M) na
unidade de dispersão (2) muda durante a operação.
(71) ISHIDA CO., LTD. (JP)
(72) MASAYA FUJII
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT JP2006/318710 de 21/09/2006
(87) WO 2007/034859 de 29/03/2007
(21) PI 0616162-6 A2 (22) 19/09/2006
1.3
(30) 20/09/2005 JP 2005-272403
(51) C21B 7/00 (2006.01)
(54) MÉTODO DE REMOÇÃO DE FERRO GUSA RESIDUAL DE ALTO
FORNO
(57) MÉTODO DE REMOÇÃO DE FERRO GUSA RESIDUAL DE ALTO
FORNO. A presente invenção refere-se a um método para puxar para fora do
forno e remover ferro gusa residual solidificado remanescente na soleira do
forno no momento de reparo de um alto forno como blocos de ferro gusa
residual dividido, e compreende a remoção do invólucro de ferro na peça para
puxar para fora os blocos de ferro gusa residual, perfurar o fundo do ferro gusa
residual através do qual uma serra de fio é passada nos refratá- rios do fundo
do forno no fundo do ferro gusa residual, passando uma serra de fio no furo do
fundo do ferro gusa residual, envolvendo a serra na circun- ferência externa do
ferro gusa residual, operar a serra de fio para cortar o ferro gusa residual e os
refratários no fundo do forno na direção longitudinal para dividir o ferro em uma
pluralidade de blocos de ferro gusa residual, e retirar os blocos de ferro gusa
residual para fora do forno de modo a remover o ferro gusa residual solidificado
com segurança em um curto tempo.
(71) NIPPON STEEL ENGINEERING CO., LTD. (JP)
(72) YUICHI TAKEDA, YUUZI SUDOU, TAKASHI HAMADA, HIROSHI
TAKASAKI
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 19/03/2008
(86) PCT JP2006/318890 de 19/09/2006
(87) WO 2007/034928 de 29/03/2007
50
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(86) PCT EP2006/008636 de 05/09/2006
(87) WO 2007/033760 de 29/03/2007
(21) PI 0616163-4 A2 (22) 13/09/2006
1.3
(30) 15/09/2005 US 11/227,768
(51) F21V 7/04 (2006.01), H05B 37/02 (2006.01)
(54) MÓDULO DE ILUMINAÇÃO PARA LANTERNAS, MÓDULO DE LED
PARA UMA LANTERNA E MÓDULO DE LED
(57) MÓDULO DE ILUMINAÇÃO PARA LANTERNAS, MÓDULO DE LED
PARA UMA LANTERNA E MÓDULO DE LED. A presente invenção refere-se a
um módulo de LED aperfeiçoa- do que é termicamente auto-estabilizador, e que
é capaz de ser retroajusta- do em uma lanterna existente. Em uma modalidade,
o módulo de LED inclui um diodo emissor de luz, um circuito de amplificação e
um microchip. O circuito de amplificação inclui um dispositivo sensor de
temperatura para sentir o calor do diodo emissor de luz. A saída do circuito de
amplificação é inseri- da no microchip que fornece como saída para um
dispositivo de comutação que regula a energia que é entregue ao diodo emissor
de luz. O dispositivo de comutação pode ser parte de um circuito de reforço, um
circuito de neu- tralização ou um circuito inversor.
(71) MAG INSTRUMENT, INC (US)
(72) STACEY H. WEST
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT US2006/035764 de 13/09/2006
(87) WO 2007/035390 de 29/03/2007
(21) PI 0616165-0 A2 (22) 14/09/2006
1.3
(30) 15/09/2005 JP 2005-268318
(51) A61N 1/30 (2006.01)
(54) DISPOSITIVO DE IONTOFORESE DO TIPO DE HASTE
(57) DISPOSITIVO DE IONTOFORESE DO TIPO DE HASTE. A presente
invenção refere-se a um dispositivo de iontoforese do tipo de haste 10 que inclui
um pequeno conjunto de eletrodo de lado em fun- cionamento 12 e um pequeno
conjunto de eletrodo de lado que não está em funcionamento 14 na ponta da
porção de suporte 20, onde uma primeira membrana de troca de íon 44 e uma
quarta membrana de troca de íon 54 nas pontas dos conjuntos são trazidas em
contato próximo, por exemplo, com o campo do câncer de pele de modo que
uma solução de fármaco é permeada por iontoforese de modo exato; o conjunto
de eletrodo de lado em funcionamento 12 e o conjunto de eletrodo de lado que
não está em funcio- namento 14 são fixados à ponta de um membro em forma
de haste 16, o membro em forma de haste 16 é destacável a partir da ponta da
porção de suporte 20, e é intercambiável integralmente com a porção.
(71) TTI ELLEBEAU, INC. (JP)
(72) HIDERO AKIYAMA, MIZUO NAKAYAMA, TAKEHIKO MATSUMURA,
AKIHIKO MATSUMURA
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT JP2006/318295 de 14/09/2006
(87) WO 2007/032446 de 22/03/2007
(21) PI 0616166-9 A2 (22) 14/09/2006
1.3
(30) 16/09/2005 JP 2005-270862
(51) A61N 1/30 (2006.01), A61M 25/00 (2006.01)
(54) DISPOSITIVO DE IONTOFORESE DO TIPO DE CATETER
(57) DISPOSITIVO DE IONTOFORESE DO TIPO DE CATETER. A presente
invenção refere-se a um dispositivo de lontoforese do tipo de cateter (10) que
inclui um pequeno conjunto de eletrodo de lado em funcionamento (12) e um
pequeno conjunto de eletrodo de lado que não está em funcionamento (14) na
ponta de um dispositivo endoscópico (20). A primeira membrana de troca de íon
(44) e a quarta membrana de troca de íon (54) nas pontas dos conjuntos são
trazidas em contato próximo, por exemplo, com o campo do câncer de um
órgáo digestivo de modo que uma solu- ção de droga é induzida a permear por
lontoforese de modo exato. Cada um de conjunto de eletrodo de lado em
funcionamento (12) e o conjunto de eletrodo de lado que não está em
funcionamento (14) é fixado à ponta of um membro em forma de barra (16). O
membro em forma de barra (16) é destacável a partir da ponta do cabo flexível
(18) e, consequentemente, é inter- cambiável integralmente com o cabo.
(71) TTI ELLEBEAU, INC. (JP)
(72) HIDERO AKIYAMA, HIROYOSHI KAWAKAMI, MIZUO NAKAYAMA,
TAKEHIKO MATSUMURA, AKIHIKO MATSUMURA
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT JP2006/318239 de 14/09/2006
(87) WO 2007/032423 de 22/03/2007
(21) PI 0616164-2 A2 (22) 05/09/2006
1.3
(30) 16/09/2005 DE 10 2005 044 314.1
(51) C08G 18/10 (2006.01), C08G 18/28 (2006.01)
(54) MASSAS DE GEL BASEADAS EM POLIURETANO, A SUA PRODUÇÃO E
USO
(57) MASSAS DE GEL BASEADAS EM POLIURETANO, SUA PRODUÇÃO E
USO. A presente invenção refere-se a massas de gel aperfeiçoadas com base
em uma mistura de reação de pré-polimeros de NCO e compostos selecionados
contendo grupamentos que são reativos para grupamentos isocianato, para um
processo para a produção dessas massas de gel e ao seu uso em elementos
de distribuição de pressão.
(71) BAYER MATERIALSCIENCE AG (DE)
(72) HEINZ-DIETER EBERT, ANDREAS HOFFMANN
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 51
para baixar PS dados são selecionados de acordo com PS referidos processos
de autenticação e detecção, com ajuda das unidades de controle, para fins de
configuração, quando o suporte de dados é ligado ao respectivo aparelho, e a
entrada e leitura, bem como a remoção de áreas de memória da memória de
dados só são possíveis depois de o processo de autenticação ter sido realizado
com sucesso.
(71) ELEKTRONIC THOMA GMBH (DE)
(72) JOACHIM BECKER, GERALD KRAFT, HEINRICH THOMA
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT EP2006/008561 de 01/09/2006
(87) WO 2007/033756 de 29/03/2007
(21) PI 0616167-7 A2 (22) 15/09/2006
1.3
(30) 15/09/2005 US 60/717,490
(51) A61B 5/00 (2006.01)
(54) DISPOSITIVO DE CARACTERIZAÇÃO ÓTICA DA PELE
(57) DISPOSITIVO DE CARACTERIZAÇÃO ÓTICA DA PELE. A presente
invenção refere-se a dispositivos dermatológicos e a processos em que uma ou
mais características de pele, tais como índice de melanina, são determinadas
pela análise da radiação redispersa de uma região da pele iluminada por pelo
menos um, de preferência, dois ou mais comprimentos de onda, por exemplo,
em uma faixa de cerca de 600 nm a cerca de 900 nm. Em muitas
concretizações, a radiação é acoplada à pele via uma guia de onda e um
sensor ótico é empregado para detectar o conta- to entre a guia de onda (por
exemplo, uma superfície da guia de onda adap- tada para contato com a pele) e
a pele.
(71) Palomar Medical Technologies, INC. (US)
(72) GREGORY ALTSHULER, GUANGMING WANG, HENRY ZENZIE
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT US2006/035927 de 15/09/2006
(87) WO 2007/035444 de 29/03/2007
(21) PI 0616168-5 A2 (22) 01/09/2006
1.3
(30) 16/09/2005 DE 10 2005 044 483.0
(51) G06F 13/40 (2006.01), G06F 21/00 (2006.01)
(54) SUPORTE DE DADOS CONFIGURÁVEL, TRANSPORTÁVEL, PARA
TROCA DE DADOS ENTRE APARELHOS ELÉTRICOS E PROCESSOS PARA
ESSE FIM
(57) SUPORTE DE DADOS CONFIGURAVEL, TRANSPORTÁVEL, PARA
TROCA DE DADOS ENTRE APARELHOS ELÉTRICOS E PROCESSOS PARA
ESSE FIM. A presente invenção refere-se a aplicação diversos, são conhecidos suportes de dados transportáveis, configurados de forma correspondente, para possibilitar uma configuração individual, particularmente ajustá- vel
automaticamente, interativa, e também possibilitar a usuários inexperien- tes
transferir dados rapidamente, está previsto de acordo com a invenção que o
suporte de dados apresenta um único circuito de interface para ligação ao
respectivo aparelho, uma memória de dados para armazenamento tem- porário
dos dados alimentados pelo respectivo aparelho, meios de entrada e exibição
para operação controlada pelo usuário e orientação do usuário, e um dispositivo
de controle que está ligado aos mesmos, com memória de programa para a
execução de programas de aplicação e de funções de comunicação, de tal
modo que um processo de autenticação é realizado, o modo de transferência
(master/slave) e a direção da transferência de dados são detectados
automaticamente, e o modo/velocidade/protocolo de trans- missão adequados
(21) PI 0616169-3 A2 (22) 18/09/2006
1.3
(30) 16/09/2005 IN 1125/MUM/2005; 20/12/2005 US 60/751.834; 17/01/2006 IN
75/MUM/2006; 24/03/2006 IN 437/MUM/2006
(51) C07D 211/90 (2006.01)
(54) FORMA POLIMÓRFICA DE CLORIDRATO DE LERCANIDIPINA E
PROCESSO PARA PREPARAÇÃO DA MESMA, BEM COMO COMPOSIÇÃO
FARMACÊUTICA CONTENDO TAL COMPOSTO
(57) FORMA POLIMORFICA DE CLORIDRATO DE LERCANIDIPINA E
PROCESSO PARA PREPARAÇAO DA MESMA, BEM COMO COMPOSIÇAO
FARMACEUTICA CONTENDO TAL COMPOSTO Processos para a purificação
de cloridrato de ler canidipina são providos os quais usam um sistema binário
de um solvente contendo álcool tal como metanol e um solvente contendo éster
alifático tal como acetato de isopropil. Pro- cessos para a preparação de
cloridrato de lercanidipina substancialmente amorfo são também providos.
Também provido é cloridrato de lercanidipina substancialmente na forma polimorfa V.
(71) GLENMARK PHARMACEUTICALS LIMITED (IN)
(72) MALOYESH MATHURESH BISWAS, MUBEEN AHMED KHAN,
SUKUMAR SINHA, NITIN SHARAD CHANDRA PRADHAN, MANGESH
SHIVRAM SAWANT
(74) NELLIE ANNE DANIEL SHORES
(85) 17/03/2008
(86) PCT IB2006/002579 de 18/09/2006
(87) WO 2007/031865 de 22/03/2007
(21) PI 0616170-7 A2 (22) 15/09/2006
1.3
(30) 19/09/2005 SE 05 02071-4
(51) B65D 33/16 (2006.01), B65D 75/58 (2006.01)
(54) RECIPIENTE, MEIOS DE FECHAMENTO E USO DOS MESMOS
(57) RECIPIENTE, MEIOS DE FECHAMENTO E USO DOS MESMOS. A
presente invenção refere-se a um recipiente (1) para conteúdos líquidos,
compreendendo um meio de fechamento para fechar novamente o recipiente. O
recipiente tem uma porção de tubo de derramamento (6) feita de duas paredes
laterais opostas (2) e dotada de uma aba de extremidade removível (8). O meio
de fechamento compreende um meio de espre- medura (7), que é
permanentemente disposto na referida porção de tubo de derramamento (6) e
compreende uma primeira e segunda pernas (9, 10), que são unidas uma à
outra por um meio de junção (11). O meio de fecha- mento também
compreende uma porção de conexão (20, 21), que é permanentemente
conectada à porção de tubo de derramamento (6) e um meio de junção (19),
que é disposto entre o meio de junção (11) e a porção de conexão (20, 21). O
meio de junção permite a virada relativa mútua das primeira e segunda pernas
para abrir e fechar o meio de espremedura. A invenção também refere-se a um
meio de fechamento para fechar novamente o recipiente e ao uso desse meio
de fechamento para abertura e fechamento de um recipiente.
(71) Eco Lean Research & Development A/S (DK)
(72) Per Abrahamsson, Per Gustafsson
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT SE2006/001051 de 15/09/2006
(87) WO 2007/035150 de 29/03/2007
52
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0616171-5 A2 (22) 12/09/2006
1.3
(30) 16/09/2005 ZA 2005/07471; 12/10/2005 ZA 2005/08238
(51) A01N 57/20 (2006.01), A01N 43/40 (2006.01), A01N 61/00 (2006.01),
A01N 43/56 (2006.01), A01N 43/90 (2006.01), A01P 13/00 (2006.01)
(54) MÉTODO PARA CONTROLAR PLANTAS
(57) MÉTODO PARA CONTROLAR PLANTAS.A presente invenção refere-se a
método para controlar plantas que são resistentes ao paraquat ou glufosinato,
em que o método compreende aplicar às plantas ou a um local das plantas uma
combinação sinergística de um inibidor de PS1 e inibidor de glutamina
sintetase.
(71) SYNGENTA LIMITED (GB)
(72) Andrew Lawrence Patrick Cairns, Mark Andrew Spinney
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT GB2006/003377 de 12/09/2006
(87) WO 2007/031735 de 22/03/2007
(21) PI 0616172-3 A2 (22) 06/09/2006
1.3
(30) 16/09/2005 US 60/717.721; 01/12/2005 US 11/291.235
(51) C08L 83/04 (2006.01), C09D 183/08 (2006.01), C08G 18/10 (2006.01)
(54) COMPOSIÇÃO PARA PROMOÇÃO DE ADESÃO, COMPOSIÇÃO
SELANTE, ADESIVA OU DE REVESTIMENTO, BEM COMO PROCESSO
PARA TRATAR SUBSTRATOS
(57) COMPOSIÇAO PARA PROMOÇAO DE ADESAO, COMPOSIÇAO
SELANTE, ADESIVA OU DE REVESTIMENTO, BEM COMO PROCESSO
PARA TRATAR SUBSTRATOS Trata-se de uma composição de promotor de
adesão que é vantajosamente empregada para melhorar a ligação de
selantes/adesivos/reVeStimefltos tais como polímeros sililados curáveis por
umidade em vários substratos tal como concreto úmido ou seco.
(71) MOMENTIVE PERFORMANCE MATERIALS INC. (US)
(72) REMY GAUTHIER, CHRISTINE LACROIX
(74) NELLIE ANNE DANIEL SHORES
(85) 17/03/2008
(86) PCT US2006/034590 de 06/09/2006
(87) WO 2007/035255 de 29/03/2007
(21) PI 0616173-1 A2 (22) 16/08/2006
1.3
(30) 15/09/2005 US 11/227.918
(51) C07F 7/18 (2006.01)
(54) MÉTODO PARA PRODUÇÃO DE ISOCIANATOSSILANOS
(57) MÉTODO PARA PRODUÇÃO DE ISOCIANATOSSILANOS Um processo é
fornecido para a produção de isocia- natossilano de sililorganocarbamato,
neutralizando-se o catalisador básico com um ácido para fornecer um sal de
haleto de metal inerte, e submetendo a mistura reacional às condiçôes da
reação de craqueamento para obter o isocianatossilano.
(71) MOMENTIVE PERFORMANCE MATERIALS INC. (US)
(72) SHAWN R. CHILDRESS, ROBERT E. SHERIDAN, JAMES L. MCINTYRE
(74) NELLIE ANNE DANIEL SHORES
(85) 17/03/2008
(86) PCT US2006/031821 de 16/08/2006
(87) WO 2007/037817 de 05/04/2007
RPI 2109 de 07/06/2011
(21) PI 0616174-0 A2 (22) 15/09/2006
1.3
(30) 15/09/2005 FR 05 09430; 19/10/2005 FR 05 10634
(51) G06K 17/00 (2006.01)
(54) MÁQUINA DE PERSONALIZAÇÃO DE ALTA VELOCIDADE
(57) MÁQUINA DE PERSONALIZAÇÃO DE ALTA VELOCIDADE. A presente
invenção refere-se a uma máquina de alta velocidade para personalizar objetos
portáteis, incorporando um circuito integrado que compreende pelo menos uma
memória, a máquina compreendendo um dis- positivo de transferência (3) para
os objetos portáteis a serem personaliza- dos e um tambor rotativo compacto
(20) contendo uma pluralidade de circuitos eletrônicos de interface, chamado
acopladores, cada um destes acopladores é ligado a, pelo menos, uma estação
de personalização (22i) composta por, pelo menos, um dispositivo de ligação
com o circuito integrado de um objeto portátil, caracterizada primeiramente por
cada um destes acopladores ser montado de forma removível de modo que
pode se adaptar ao tipo de programação utilizada para os dados de
personalização e, em segundo lugar, pelas estações de personalização (22i)
também serem removíveis para a sua adaptação ao tipo de objetos portáteis
(4), a serem personalizados e/ou aos acopladores utilizados, o tambor rotativo
(20) compreendendo seções de ranhuras que contêm uma pluralidade de
ranhuras para engate das estações de pe rsonalizaçáo (22i).
(71) Datacard Corporation (US)
(72) ERIC AUBOUSSIER, BENOIT BERTHE, YANNICK SUZANNE
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT IB2006/002546 de 15/09/2006
(87) WO 2007/031856 de 22/03/2007
(21) PI 0616175-8 A2 (22) 03/04/2006
1.3
(30) 21/09/2005 TR 2005/03780
(51) D01H 7/22 (2006.01)
(54) TRAVADOR DE FUSO DE ANEL AUTOMÁTICO (MÁQUINA DE FIO)
(57) TRAVADOR DE FUSO DE ANEL AUTOMÁTICO (MÁQUINA DE FIO). Esta
invenção refere-se ao travador de fuso, o qual pára o fuso após uma ruptura de
fio. O travador de fuso de anel automático, o qual é melhorado por esta
invenção, é caracterizado por ter uma bobina de campo magnético, a qual
consiste em uma parte enrolada (2), uma guia (3), uma caixa traseira, a qual
cobre os indutores de campo magnético (5) e um cam- po magnético, um metal
de inserção (6) e seu topo (14), um mecanismo de travamento (8 e 9); um braço
de parada com canais em T e I nele, uma parte de conexão principal (1) e um
componente de conexão (15).
(71) SANKO TEKSTILISLETMELERI SAN. VE TIC. A.S. (TR)
(72) HAKAN KONUKOGLU, AHMET GOKHAN AYDIN
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT TR2006/000011 de 03/04/2006
(87) WO 2007/035175 de 29/03/2007
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 53
(85) 17/03/2008
(86) PCT EP2006/009094 de 19/09/2006
(87) WO 2007/039096 de 12/04/2007
(21) PI 0616176-6 A2 (22) 01/11/2006
1.3
(30) 01/11/2005 US 11/265.390
(51) A47K 7/03 (2006.01)
(54) SUBSTRATO E UTENSÍLIO DE CUIDADO PESSOAL PARA SAÚDE,
HIGIENE E/OU APLICAÇÃO(ÕES) AMBIENTAL(IS) E MÉTODO PARA FAZER
O CITADO SUBTRATO E UTENSÍLIO DE CUIDADO PESSOAL
(57) SUBSTRATO E UTENSÍLIO DE CUIDADO PESSOAL PARA SAÚDE,
HIGIENE E/OU APLICAÇAO(OES) AMBIENTAL(IS) E METODO PARA FAZER
O CITADO SUSTRATO E UTENSÍLIO DE CUIDADO PESSOAL Substratos,e
utensílios de cuidado pessoal feitos de tais substratos, incluem uma camada de
fibras interligadas que têm descontinuidades modeladas e fios de fortalecimento
aderidos à citada camada de fibras interligadas. Poros entre as fibras na
camada de fibras interligadas são apro- priados para auxiliar a reter liquido. As
descontinuidades modeladas são apropriadas para auxiliar a gerar espuma ou
espuma de sabão o substrato ou utensílio de cuidado pessoal deve ser usado
em combinação com uma composição de limpeza, formulação de sabonete, ou
outro material semelhante que tenha um agente ativo de superfície ou outro
químico ou com- posto que auxilie a gerar espuma. Os fios de fortalecimento
auxiliam a força, ou melhoram a elasticidade úmida de, a ca- mada de fibras
interligadas. Além do mais, pela seleção dos ingredientes apropriados dos fios
de fortalecimento, os fios podem ser mais grossos que a camada de fibras
interligadas; auxiliando desse modo a prover alguma característica de
esfoliação ao substrato ou utensílio de cuidado pessoal.
(71) KIMBERLY-CLARK WORLDWIDE INC. (US)
(72) KENNETH B. CLOSE, JONATHAN K. ARENDT, GARY V. ANDERSON,
THOMAS VERCAUTEREN, WAEL R. JOSEPH, BHASKARA C.
CHILAKAMARRI, KROY D. JOHNSON, TIMOTHY M. MCFARLAND
(74) NELLIE ANNE DANIEL SHORES
(85) 17/03/2008
(86) PCT US2006/042852 de 01/11/2006
(87) WO 2007/053756 de 10/05/2007
(21) PI 0616177-4 A2 (22) 19/09/2006
1.3
(30) 19/09/2005 DE 10 2005 044 712.0; 20/09/2005 US 60/718.672
(51) H05K 7/14 (2006.01)
(54) SISTEMA DE TRANSPORTE DE EQUIPAMENTO AVIÔNICO COM
ALOJAMENTO E MÓDULOS DE MONTAGEM RÁPIDA
(57) SISTEMA DE TRANSPORTE DE EQUIPAMENTO AVIONICO COM
ALOJAMENTO E MÓDULOS DE MONTAGEM RAPIDA A aplicação descreve
um sistema de transporte de equipamento aviânico para módulos deslizantes
com dispositivos de processamento de dados, transmissão de dados,
armazenamento de dados, ou de exibição de dados, tais como, por exemplo,
placas de circuito eletrônico impresso, componentes de rede, dispositivos de
armazenamento, dispositivos de tela e similares, ou dispositivos de fonte de
alimentação, que compreende um alojamento, de no mínimo um bastidor de
módu- los para acomodar os módulos deslizantes e no mínimo uma placa mãe
com arquitetura de conexão de Ethernet. Quando as dimensões do alojamento
obedecem aos padrões ARINO, e o alo- jamento é arranjado para instalação
em um bastidor de módu- los avíônicos como um alojamento de montagem
rápida, e quaisquer placas de circuito desejadas de um formato padrão
específico podem ser usada nos módulos deslizantes que são designados
como módulos de montagem rápida.
(71) AIRBUS DEUTSCHLAND GMBH (DE)
(72) STEFAN OSTERNACK, OLIVER SCHALKE, SVEN REHMEIER, JÖRG
BRADTKE
(74) NELLIE ANNE DANIEL SHORES
(21) PI 0616178-2 A2 (22) 12/09/2006
1.3
(30) 16/09/2005 EP 05 077104.7
(51) C02F 1/62 (2006.01), C07K 14/79 (2006.01)
(54) MATERIAL E MÉTODO PARA REMOVER OXO-ÂNIONS E CÁTIONS
METÁLICOS DE UM LÍQUIDO
(57) MATERIAL E MÉTODO PARA REMOVER OXO- ÁNIONS E CÁTIONS
METÁLICOS DE UM LÍQUIDO. A presente invenção refere-se a um material
para remover oxo- ánions e cátions metálicos de um líquido. Este material é
caracterizado pelo fato de que este compreende ferritina hipertermofílica. A
presente invenção também se refere a um método para remover pelo menos
um dos oxoánions e cátions metálicos de um líquido. Este método é
caracterizado pelo fato de que um material que compreende ferritina
hipertermofílica é usado como material de filtro. É especialmente preferido que
o dito líquido seja composto de água. A invenção também se refere ao uso de
ferritina hiper- termofílica para remover cátions metálicos e oxo-ânions de um
líquido.
(71) TECHNISCHE UNIVERSITEIT DELFT (NL)
(72) MUHAMMAD NAHIDUL HASAN, MARINUS CORNELIS MARIA VAN
LOOSDRECHT, WILFRED RAYMOND HAGEN
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT EP2006/066277 de 12/09/2006
(87) WO 2007/031515 de 22/03/2007
(21) PI 0616179-0 A2 (22) 15/09/2006
1.3
(30) 16/09/2005 JP 2005-269803
(51) H04J 11/00 (2006.01), H04Q 7/38 (2009.01)
(54) DISPOSITIVO DE TRANSMISSÃO DE RÁDIO, DISPOSITIVO DE
RECEPÇÃO DE RÁDIO, MÉTODO DE TRANSMISSÃO DE RÁDIO E MÉTODO
DE RECEPÇÃO DE RÁDIO
(57) DISPOSITIVO DE TRANSMISSÃO DE RÁDIO, DISPOSITIVO DE
RECEPÇÃO DE RÁDIO, MÉTODO DE TRANSMISSÃO DE RÁDIO E MÉTODO
DE RECEPÇÃO DE RÁDIO.Trata-se de um dispositivo de transmissão de rádio
para suavi- zar a distorção de forma de onda de um sinal recebido em uma
transmissão de portadora simples, a despeito de um estado de
desvanecimento. Neste dispositivo, uma unidade FFT (103) converte um sinal
de modulação produ- zido por uma unidade de modulação (102) em um sinal de
uma faixa de frequência e uma unidade de repetição (104) repete o sinal na
faixa de frequência produzido pela unidade FFT (103) e dispõe uma pluralidade
de sinais da faixa de freqúência adjacentes entre si em um eixo geométrico de
freqúência. Uma unidade de formação de forma de onda em formato de dente
9105) conforma a forma de onda dos sinais da faixa de freqúência produ- zidos
pela unidade de repetição (104) em uma forma de onda em formato de dente e
uma unidade IFFT (106) converte o sinal de faixa de frequência produzido pela
unidade de formação de forma de onda em formato de dente (105) em um sinal
de uma faixa de tempo.
(71) MATSUSHITA ELECTRIC INDUSTRIAL CO, LTD (JP)
(72) ATSUSHI MATSUMOTO, DAICHI IMAMURA, SADAKI FUTAGI
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT JP2006/318415 de 15/09/2006
(87) WO 2007/032491 de 22/03/2007
(21) PI 0616180-4 A2 (22) 11/09/2006
1.3
(30) 15/09/2005 DE 10 2005 044 241.2; 09/02/2006 EP 06 002606.9
(51) F24J 2/10 (2006.01)
(54) PROCESSO PARA A PRODUÇÃO DE UM ESPELHO ÓTICO
(57) PROCESSO PARA A PRODUÇÃO DE UM ESPE LHO ÓTICO. A presente
invenção refere-se a produção de heliástatos empre- gados em usinas termosolares, o processo de acordo com a invenção prevê que um disco de espelho
(1), mediante o emprego de uma forma requerida (5) e mediante a intercalação
de meio de aderência (6), seja assentado sobre uma construção de suporte (2).
A forma requerida (5) e a posição em relação a um ponto de referência definido
são transmitidas ao disco de espe- lho (1) e modeladas no meio de aderência
54
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(6). Depois do endurecimento do meio de aderência (6), a forma requerida (5) é
removida, e depois disso a sua forma fica gravada no disco de espelho (1).
(71) NOVATEC BIOSOL AG (DE)
(72) MARTIN SELIG, MAX MERTINS
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT DE2006/001596 de 11/09/2006
(87) WO 2007/031062 de 22/03/2007
(21) PI 0616183-9 A2 (22) 07/09/2006
1.3
(30) 15/09/2005 DE 10 2005 044 177.7
(51) C07C 17/02 (2006.01), C07C 19/045 (2006.01)
(54) PROCESSO PARA OPERAÇÃO DE UMA COLUNA DE DESTILAÇÃO
PARA A PURIFICAÇÃO DE 1,2-DICLOROETANO E PARA A
CONCENTRAÇÃO ACOPLADA DE SOLUÇÃO DE SODA CÁUSTICA
ATRAVÉS DE EVAPORAÇÃO
(57) PROCESSO PARA OPERAÇÃO DE UMA COLUNA DE DESTILAÇÃO
PARA A PURIFICAÇÃO DE 1,2-DICLOROETANO E PARA A
CONCENTRAÇÃO ACOPLADA DE SOLUÇÃO DE SODA CÁUSTICA
ATRAVÉS DE EVAPORAÇÃO. A presente invenção refere-se a um processo
para operação de uma coluna de destilação para a remoção de água e
componentes com um ponto de ebulição menor do que o 1 ,2-dicloroetano do 1
,2-dicloroetano no qual pelo menos parte do calor da condensação dos vapores
aquosos da coluna de destilação é usada para concentrar a solução de soda
cáustica através de evaporação; além disso, pelo menos parte do 1 ,2dicloroetano formado quando cloro e etileno reagem em uma unidade de
cloração direta é usada para aquecer a referida coluna de destilação e pode,
subsequentemente, também ser usada como um fluido de transferência de
calor para concentrar a solução de soda cáustica através de evaporação. um
anel heterociclico não-aromático, não-substituido ou substituido or um ou dois
substituintes, selecionados do grupo que consiste em C(0)0- alquila inferior,
alquila inferior, alquila inferior substituida por halogênio, ci- loalquila, hidrôxi,
halogênio, N(R)C(0)-alquila inferior, -(CH2) n-O-aIquiIa inferior, ou por um anel
heterociclico aromático; R é hidrogênio, hidróxi, ou alquila inferior, em que R
pode ser o mesmo u diferente no caso de R2; '/R" são independentemente um
do outro hidrogênio ou alquila inferior; éO,1,2,3ou4; m él,2ou3; e com seus sais
de adição de ácido farmaceuticamente aceitáveis. Foi constatado que esta
classe de compostos apresenta alta afinidade e seletividade com relação aos
sitios de ligação de receptor de GABA A 5 e poderia ser útil como realçador
cognitivo ou para o tratamento de dis- túrbios cognitivos como a doença de
Alzheimer.
(71) Uhde GMBH (DE) , Vinnolit Gmbh & CO.KG (DE)
(72) SVEN PETERSEN, MICHAEL BENJE, PETER KAMMERHOFER
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT EP2006/008703 de 07/09/2006
(87) WO 2007/031223 de 22/03/2007
(21) PI 0616184-7 A2 (22) 07/09/2006
1.3
(30) 19/09/2005 EP 05 108599.1
(51) C07D 413/14 (2006.01), C07D 413/06 (2006.01), C07D 451/06 (2006.01),
A61P 25/28 (2006.01), A61K 31/42 (2006.01)
(54) DERIVADOS DE ISOXAZOLO COMO AGONISTAS INVERSOS GABA A
ALFA 5, PROCESSO PARA A PREPARAÇÃO DOS MESMOS,
MEDICAMENTO E USO DOS REFERIDOS DERIVADOS
(57) DERIVADOS DE ISOXAZOLO COMO AGONISTAS INVERSOS GABA A
ALFA 5, PROCESSO PARA A PREPARAÇÃO DOS MESMOS,
MEDICAMENTO E USO DOS REFERIDOS DERIVADOS. A presente invenção
refere-se a derivados de amida de ácido aril-isoxazol-4-carbonil-pirrol-2carboxílico de fórmula em que R1 é hidrogênio, halogênio, alcóxi inferior, fenilóxi
ou benzilóxi; R2 é alquila inferior, (CH2) n-O-aIquiIa inferior ou fenila; R3 é
hidrogênio ou alquila inferior; R4/R5 são independentemente um do outro
hidrogênio, alquila inferior, alquila inferior substituida por halogênio, alquinila
inferior ou -(CHR) n-ariIa, não-substituida ou substituida por halogênio, alquila
inferior ou alcóxi inferior, anel heterociclico não-aromático de -(CH2) n-, nãosubstituído ou substituído por um ou dois grupos alquila inferior, anéis
heterocíclicos aromáticos de -(CH2) n-, -(CR2) n-cicloalquila, não-substituida ou
substituida por um a três substituintes, selecionados do grupo que consiste em
hidróxi ou alquila inferior, -(CHR) n-O-alquila inferior, -(CR2) n-OH, -(CHR) nNR’R’’, ou R4/R5 formam junto com o átomo de N ao qual eles estão ligados o
anel - 8-aza-biciclo[3.2.1]octano, substituído por hidróxi, ou - 3,4-di-idro-1 Hisoquinolina, ou - um anel heterocíclico não-aromático, não-substituído ou
substituído por um ou dois substituintes, selecionados do grupo que consiste
em C(O)O-alquila inferior, alquila inferior, alquila inferior substituída por
halogênio, cicloalquila, hidróxi, halogênio, N(R)C(O)-alquila inferior, -(CH2) n-Oalquila inferior, ou por um anel heterocíclico aromático; R é hidrogênio, hidróxi
ou alquila inferior, em que R pode ser o mesmo ou diferente no caso de R2;
R’/R" são independentemente um do outro hidrogênio ou alquila inferior; n é 0,
1, 2, 3 ou 4; m é 1, 2 ou 3; e com seus sais de adição de ácido
RPI 2109 de 07/06/2011
farmaceuticamente aceitáveis. Foi constatado que esta classe de compostos
apresenta alta afinidade e seletividade com relação aos sítios de ligação de
receptor de GABA A 5 e poderia ser útil como realçador cognitivo ou para o
tratamento de distúrbios cognitivos com a doença de Alzheimer.
(71) F Hoffmann La Roche AG (CH)
(72) BERND BUETTELMANN, BO HAN, HENNER KNUST, MATTHIAS
NETTEKOVEN, ANDREW THOMAS
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT EP2006/066094 de 07/09/2006
(87) WO 2007/039389 de 12/04/2007
(21) PI 0616185-5 A2 (22) 24/08/2006
1.3
(30) 15/09/2005 US 11/227,867
(51) C09D 133/06 (2006.01), C09D 133/14 (2006.01), C09D 201/00 (2006.01),
C09D 5/00 (2006.01), C08K 5/5455 (2006.01), C08K 5/315 (2006.01), C08K
5/3492 (2006.01), C08L 61/20 (2006.01), C08L 61/28 (2006.01)
(54) COMPOSIÇÕES DE REVESTIMENTO COM DIÓIS SILILADOS
(57) COMPOSIÇÕES DE REVESTIMENTO COM DIÓIS SILILADOS. A
presente invenção refere-se ao brilho de uma composição de revestimento
clearcoat curável que é aumentado pela adição de cerca de 1% a cerca de 10%
em peso de um dímero sililado de diol de álcool graxo.
(71) BASF CORPORATION (US)
(72) Sunitha Grandhee, Swaminathan Ramesh
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 17/03/2008
(86) PCT US2006/033036 de 24/08/2006
(87) WO 2007/037857 de 05/04/2007
(21) PI 0616186-3 A2 (22) 21/09/2006
1.3
(30) 23/09/2005 EP 05108810.2
(51) C07D 239/42 (2006.01), C07D 239/34 (2006.01), C07D 239/38 (2006.01),
C07D 239/36 (2006.01), C07D 403/04 (2006.01), C07D 401/04 (2006.01), C07D
403/12 (2006.01), C07D 401/12 (2006.01), A61K 31/505 (2006.01), A61K
31/506 (2006.01), A61P 19/10 (2006.01), A61P 9/10 (2006.01)
(54) DERIVADO DE 4-FENIL-6-SUBSTITUÍDO-PIRIMIDINA-2-CARBONITRILA
OU UM SAL FARMACEUTICAMENTE ACEITÁVEL DO MESMO,
COMPOSIÇÃO FARMACÊUTICA, E, USO DE UM DERIVADO DE 4-FENIL-6SUBSTITUÍDO-PIRIMIDINA-2-CARBONITRILA
(57) DERIVADO DE 4-FENIL-6-SUBSTITUIDO-PIRIMIDINA-2- CARBONITRILA
OU UM SAL FARMACEUTICAMENTE ACEITÁVEL DO MESMO,
COMPOSIÇÃO FARMACÊUTICA, E, USO DE UM DERIVADO DE 4-FENILSUBSTITUÍDO-PIRIMIDINA-2-CARBONITRILA A invenção refere-se a
derivados de 4-fenil-6-substituído- pirimidina-2-carbonitrila tendo a Fórmula
(I)em que R representa 1 - 3 substituintes opcionais independentemente
selecionados de (C1-C4)- alquila (opcionalmente substituida com um ou mais
halogênios), (C1-C4)alquilóxi (opcionalmente substituido por um ou mais
halogênios) e halogênio; X é NR1, O ou S; R1 é H ou (C1-C4)alquila, Y é (C1C4)alquila, benzila ou (C2-C6)alquila substituida por um grupo selecionado de
OH, (C1-C4)alquilóxi, NR2R3, um anel heterocíclico saturado de 4 - 8 membros,
compreendendo 1 ou 2 heteroátomos selecionados de O, S e NR4 e um grupo
heterociclico aromático de 5 ou 6 membros, compreendendo 1-4 átomos N; ou
R1 e Y formam, juntos com o nitrogênio a que eles são ligados, um anel
heterocíclico saturado de 4 - 8 membros, opcionalmente compreendendo um
outro heteroátomo selecionado de O, S, NR4 e NO; o anel sendo opcionalmente
substituído por NR2R3 ou por 1 a 4 grupos (C1-C3)alquila; R2 e R3 formam,
juntos com o nitrogênio a que eles são ligados, um anel heterociclico saturado
de 4 - 8 membros, opcionalmente compreendendo um outro heteroátomo
selecionado de O, S e NR4; R4 é H, (C1-C6)alquila, (C3-6 )cicloalquila, (C3..
6)cicloalquil (C1- C4)alquila, (C1 -C4)alquilóxi-(C1 -C4)alquila, benzila, amido-(C1 C4)alquila, (C1-C6)alquiloxicarbonil (C1-C4)alquila ou carbóxi (C1-C4)alquila; ou
um sal farmaceuticamente aceitável do mesmo, a composições farmacêuticas
compreendendo os mesmos, bem como ao uso destes derivados 4-fenil-6substituído-pirimidina-2-carbonitrila, para a preparação de um medicamento
para o tratamento de distúrbios relacionados com a catepsina K e catepsina S,
RPI 2109 de 07/06/2011
p.ex., osteoporose, aterosclerose, inflamação e distúrbios imunes, tais como
artrite reumatóide e dor crônica.
(71) N.V. ORGANON (NL)
(72) Zoran Rankovic, Jiaqiang Cai
(74) Momsen, Leonardos & CIA.
(85) 20/03/2008
(86) PCT EP2006/066562 de 21/09/2006
(87) WO 2007/039470 de 12/04/2007
(21) PI 0617688-7 A2 (22) 19/10/2006
1.3
(30) 21/10/2005 EP 05 023003.6; 24/05/2006 EP 06 010665.5
(51) C12N 15/62 (2006.01)
(54) MÉTODO PARA EXPRESSÃO RECOMBINANTE DE UM POLIPEPTÍDEO
(57) MÉTODO PARA A EXPRESSÃO RECOMBINANTE DE UM
POLIPEPTÍDEO. A presente invenção refere-se a um descrito um método para
a produção recombinante de um polipeptídeo heterôlogo em uma célula
hospedeira eucariótica. A célula hospedeira compreende um plasmídeo de
expressão, em que o plasmídeo de expressão compreende em uma direção 5'
para 3' a) um promotor, b) um ácido nucléico codificando um primeiro
polipeptídeo, cuja seqúência de aminoácidos é selecionada da Tabela 1
dependendo dos dois primeiros aminoácidos do segundo polipeptídeo, c) um
ácido nucléico codificando um segundo polipeptídeo compreendendo um ácido
nucléico codificando um polipeptídeo heterólogo, um ácido nucléico codificando
um ligante, e um ácido nucléico codificando um fragmento de imunoglobulina, e
d) uma região 3 não traduzida compreendendo um sinal de poliadenilação. São
descritos adicionalmente um plasmídeo e um kit.
(71) F Hoffmann-La Roche AG (CH)
(72) Erhard Kopetzki
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 22/04/2008
(86) PCT EP2006/010067 de 19/10/2006
(87) WO 2007/045465 de 26/04/2007
(21) PI 0708269-0 A2 (22) 02/02/2007
1.3
(30) 25/02/2006 EP EP06251020
(51) C11D 3/40 (2006.01), C11D 17/00 (2006.01), C11D 7/10 (2006.01), C11D
7/12 (2006.01), C11D 3/02 (2006.01), C11D 3/10 (2006.01)
(54) GRÂNULOS DE CORANTE TONALIZANTE, SUA UTILIZAÇÃO NA
FORMULAÇÃO DE DETERGENTES E PROCESSO PARA SUA FABRICAÇÃO
(57) Grânulos de Corante Tonalizante, sua Utilização na Formulação de
Detergentes e Processo para sua Fabricação. Um grânulo para utilização como
aditivo em uma composição em pó para lavar roupas, com o grânulo tendo
distribuição da dimensão da partícula de modo que 90 % p/p sejam menores de
300 micrometros, de preferência 250 micrometros em diâmetro, com o grânulo
compreendendo: 0,05 a 0,5 % p/p de corante tonalizante substantivo de tecidos
(sólido) absorvido em pelo menos 80 % p/p de sal hidratavel.
(71) Unilever N.V (NL)
(72) Janette Cutrona
(74) ATEM & REMER ASSES. CONSUL. PROP. INT. LTDA
(85) 25/08/2008
(86) PCT EP2007/000989 de 02/02/2007
(87) WO WO2007096052 de 30/08/2007
(21) PI 0708373-4 A2 (22) 05/02/2007
1.3
(30) 17/04/2006 US 11/405.280
(51) B01F 17/00 (2006.01), C01F 7/02 (2006.01), C09C 1/40 (2006.01), C09D
201/06 (2006.01), H01B 7/02 (2006.01)
(54) MÉTODO DE PREPARAR DISPERSÃO ESTÁVEL DE NANO-ALUMINA
DERIVADA DE SOL E MÉTODO DE RESVESTIMENTO DE FIO
(57) METODO DE PREPARAR DISPERSAO ESTAVEL DE NANO-ALUMINA
DERIVADA DE SOL E METODO DE REVESTIMENTO DE FIO. Dispersão de
nano-alurnina derivada de sol em uma mistura de solvenre orgânico contendo
1,2-diol com agitação simples. Uma solução tíxotrépica é obtida a 20% de
alumínio em etileno glicol, enquanto uma solução de baixa viscosidade
(<100cps) é possível para uma solução de alumina a 20% em (1:1, Nmetilpirrolidona-etileno glicol) . Partículas de alumina são desaglomeradas com
agitação mínima. A solução resultante ou solução de resina é estável a
sedimentação e reaglomeração. A solução de dispersão de nano-alumina pode,
então, ser misturada com um revestimento de imida para fornecer um
revestimento de fio para dar ao fio melhor abrasão, COF e resistência à corona.
(71) Altana Electrial Insulation Gmbh (DE)
(72) Thomas J. Murray, Philip R. Meister
(74) Bhering Advogados
(85) 29/08/2008
(86) PCT EP2007/051062 de 05/02/2007
(87) WO 2007/118720 de 25/10/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 55
(21) PI 0708374-2 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 US 60/778,281
(51) A22C 17/02 (2006.01)
(54) CÂMARAS DE SEPARAÇÃO
(57) CÂMARAS DE SEPARAÇÃO. Uma câmara de separação particularmente
adaptada para processamento de carne é configurável de forma a ter vários
diâmetros de extremidades de carga e descarga e/ou comprimentos de câmara.
A câmara de separação pode também ter perfurações cortantes configuráveis.
(71) Weiller and Company Inc. (US)
(72) Nick J. Lesar
(74) Hugo Silva, Rosa & Maldonado
(85) 29/08/2008
(86) PCT US2007/063196 de 02/03/2007
(87) WO 2007/103799 de 13/09/2007
(21) PI 0708375-0 A2 (22) 02/03/2007
1.3
(30) 06/03/2006 US 11/368,820
(51) C10J 3/50 (2006.01), C10J 3/84 (2006.01)
(54) EQUIPAMENTO E MÉTODOS DE FORMAÇÃO DE GÁS DE SÍNTESE E
DE CARREGAMENTO DE MATERIAL CARBONÁCEO EM REATOR DE
DESVOLATILIZAÇÃO
(57) Equipamento e Métodos de Formação de Gás de Síntese e de
Carregamento de Material Carbonáceo em Reator de Desvolatilização. Um
equipamento (10) projetado para formar gás de síntese a partir de materiais
carbonados tais como carvão inclui um reator de desvolatilização (14) em
combinação com um reator de reforming (16) que subseqúentemente forma gás
de síntese, O reator de refonning, por sua vez, está em comunicação com um
separador de particulado (18). O reator de desvolatilização é carregado com
material usando um carregador de compressão (12) que dirige ar a partir do
material de carga, comprime-o numa zona de carga formando uma vedação
entre a tremonha de carga e o reator de desvolatilização. O reator de reforming
(16), assim como também os separadores de particulado (18, 20), são mantidos
num forno aquecido (77) de forma que a temperatura do gás de sintese formado
não diminui abaixo da temperatura de reação até que o material particulado
tenha sido separado.
(71) Robert E. Klepper (US)
(72) Robert E. Klepper
(74) Hugo Silva, Rosa & Maldonado
(85) 29/08/2008
(86) PCT US2007/063138 de 02/03/2007
(87) WO 2007/103771 de 13/09/2007
(21) PI 0708376-9 A2 (22) 23/02/2007
1.3
(30) 06/03/2006 US 11/276.584
(51) G06F 15/16 (2006.01), G06F 15/163 (2006.01), G06F 17/00 (2006.01)
(54) CONTROLE RSS HOSPEDÁVEL
(57) CONTROLE RSS HOSPEDÁVEL. As modalidades descritas utilizam e
alavancam RSS para habilitar um usuário a interagir mais facilmente com
diferentes tipos de dados ou com dados provenientes de diferentes fontes que
estão disponíveis na lnternet. De acordo com pelo menos algumas
modalidades, um controle hospedável e/ou customizável é fornecido e dá ao
56
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
usuário a capacidade de interagir com alimentações RSS para armazenar e
manipular adicionalmente coleções de itens de diferentes alimentações RSS.
(71) Microsoft Corporation (US)
(72) Jane T. Kim, Amar S. Gandhi, Sean O. Lyndersay
(74) Nellie Anne Daniel Shores
(85) 29/08/2008
(86) PCT US2007/004834 de 23/02/2007
(87) WO 2007/103008 de 13/09/2007
(21) PI 0708377-7 A2 (22) 21/02/2007
1.3
(30) 28/02/2006 JP 2006-052460
(51) B29B 11/16 (2006.01), B29C 43/18 (2006.01), B29C 70/10 (2006.01), B32B
5/28 (2006.01)
(54) MATERIAL DE BASE DE FIBRA DE REFORÇO PARA PRÉ-FORMAS,
PROCESSO PARA A PRODUÇÃO DE LAMINADOS A PARTIR DO MESMO, E
ASSIM POR DIANTE
(57) MATERIAL DE BASE DE FIBRA DE REFORÇO PARA PRÉ-FORMAS,
PROCESSO PARA A PRODUÇÃO DE LAMINADOS A PARTIR DO MESMO, E
ASSIM POR DIANTE. A presente invenção fornece (1) um material de base de
fibra de reforço possuindo uma trama constituída de ambos os filamentos de
fibra de reforço dispostos em uma direção em paralelo um com o outro e fios
auxiliares dispostos em outra direção, que satisfaz a relação: L = H/cos θ (onde
L é o comprimento do fio auxiliar cobrindo um filamento de fibra de reforço e H é
a largura de filamento como determinado em tal estado onde os filamentos de
fibra de reforço são unificados apenas com os fios auxiliares; e 30º  θ (tensão
de cisalhamento em plano)  30º) e onde 3 g/m2 a 40 g/m2 de uma resina
adesiva possuindo uma temperatura de transição de vidro entre 0º e 95ºÇ é
aderida a pelo menos um lado em pontos, linhas ou linhas descontínuas; (2) um
laminado obtido pela laminação de camadas do material de base de fibra de
reforço, onde a resina adesiva aderida a cada camada do material de base une
parcialmente a uma camada do material de base através de toda a superfície,
com o comprimento máximo de cada junta de união sendo não inferior a 1 mm.
e não mais do que a largura H de um filamento de fibra de reforço; e (3) uma
pré-forma, obtida pela formatação do laminado, possuindo uma fração de
volume de fibra de reforço (Vpf) de 45% a 62%.
(71) Toray Industries, Inc. (JP)
(72) Tomoyuki Shinoda, Satoru Nagaoka, Nobuo Asahara
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 28/08/2008
(86) PCT JP2007/053157 de 21/02/2007
(87) WO 2007/099825 de 07/09/2007
(21) PI 0708378-5 A2 (22) 19/02/2007
1.3
(30) 28/02/2006 US 60/777,345
(51) A61K 31/202 (2006.01), A61P 3/04 (2006.01)
(54) USO DE DHA E ARA NA PREPARAÇÃO DE UMA COMPOSIÇÃO PARA
PREVENÇÃO OU TRATAMENTO DE OBESIDADE
(57) USO DE DHA E ARA NA PREPARAÇÃO DE UMA COMPOSIÇÃO PARA
PREVENÇÃO OU TRATAMENTO DE OBESIDADE. A presente invenção
refere-se a um novo método para a prevenção ou tratamento de obesidade em
um indivíduo. O método compreende administração de uma quantidade
RPI 2109 de 07/06/2011
terapeuticamente eficaz de DHA e ARA, sozinhos ou em combinação um com o
outro, a um indivíduo.
(71) Bristol-Myers Squibb CO. (US) , Cornell Research Foundation (US)
(72) Kristin L. Morris, Steven C. Rumsey, Joshua C. Anthony, Thomas J. Brenna
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 28/08/2008
(86) PCT US2007/004421 de 19/02/2007
(87) WO 2007/100561 de 07/09/2007
(21) PI 0708379-3 A2 (22) 20/02/2007
1.3
(30) 28/02/2006 EP 06110501.1; 08/03/2006 US 60/780,712
(51) B41C 1/10 (2006.01)
(54) PRECURSOR DE CHAPA PARA IMPRESSÃO LITOGRÁFICA DE
TRABALHO POSITIVO SENSÍVEL AO CALOR, MÉTODO PARA
MANUFATURAR UMA CHAPA DE IMPRESSÃO LITOGRÁFICA E USO DE UM
POLÍMERO SOLÚVEL ALCALINO
(57) PRECURSOR DE CHAPA PARA IMPPESSAO LITOGRAFICA DE
TRABALHO POSITIVO SENSÍVEL AO CALOR, METODO PARA
MMUFATURAR UMA CHAPA DE IMPRESSAO LITOGRAFICA E USO DE UM
POLIMERO SOLUVEL ALCALINO. Expõe-se um precursor de chapa para
impressão litográfica de trabalho positivo sensível ao calor, que compreende (1)
um suporte dotado de uma superfície hídrófíla ou que é provida de uma camada
hidrófíla; (2) um revestimento sensível ao calor, que compreende um agente
absorvedor de IR, uma resina fenólíca e um primeiro polimero, caractrerízado
por o dito primeiro polimero ser um polímero solúvel alcalino que compreende
uma unidade monomérica dorada de uma estrutura de acordo com a fórmula I
ou fórmula II em que pelo menos um dos grupos aromáticos Ar1 e Ar2 e um
grupo heteroaromático opcíonalmente substituído.
(71) Agfa Graphics NV (BE)
(72) Johan Loccufier, Stefaan Lingier, Hubertus Van Aert, Jan Venneman, Marc
Van Damme
(74) Vieira de Mello, Werneck Alves - Advogados S/C
(85) 28/08/2008
(86) PCT EP2007/051612 de 20/02/2007
(87) WO 2007/099047 de 07/09/2007
(21) PI 0708381-5 A2 (22) 26/04/2007
1.3
(30) 31/05/2006 FR 0651965
(51) H03K 5/13 (2006.01)
(54) PROCESSO E DISPOSITIVO DE GERAÇÃO DE SINAIS BINÁRIOS
DEFASADOS, UTILIZAÇÃO DO PROCESSO, E, SEQÜÊNCIAS DE
INSTRUÇÕES EXECUTÁVEIS PELO DISPOSITIVO
(57) PROCESSO E DISPOSITIVO DE GERAÇÃO DE SINAIS BINÁRIOS
DEFASADOS, UTILIZAÇÃO DO PROCESSO, E, SEQUENCIAS DE
INSTRUÇÕES EXECUTÁVEIS PELO DISPOSITIVO. A invenção se refere a
um processo de geração de sinais binários defasados (So1, So2, So3) de um
ângulo de defasagem de controle () continuamente variável em relação a pelo
menos um sinal binário de sincronização de um conjunto de sinais binários de
sincronização (Si1, Si2, Si3) que têm um mesmo período variável, do tipo
daqueles que consistem em elaborar as frentes ascendentes e descendentes
dos sinais defasados (So1, So2, So3) calculando para isso pelo menos um
retardo de comutação de nível a partir de frentes de sincronização, ascendentes
ou descendentes do sinal binário de sincronização (Si1, Si2, Si3) pelo menos,
em função pelo menos do dito ângulo de defasagem de controle (). De acordo
com a invenção, pelo menos uma frente de referência é escolhida entre as
frentes de sincronização tal que o dito retardo é mínimo.
(71) Valeo Equipements Electriques Moteur (FR)
(72) Oussama Rouis
(74) Momsen, Leonardos & CIA.
(85) 28/08/2008
(86) PCT FR2007/051180 de 26/04/2007
(87) WO 2007/138202 de 06/12/2007
(21) PI 0708382-3 A2 (22) 27/04/2007
1.3
(30) 31/05/2006 FR 0651975
(51) H02P 9/08 (2006.01), H02P 6/16 (2006.01)
(54) PROCESSO E DISPOSITIVO DE GERAÇÃO DE SINAIS DE COMANDO
DE UMA MÁQUINA ELÉTRICA GIRATÓRIA POLIFÁSICA E SEQÜÊNCIAS DE
INSTRUÇÕES
(57) PROCESSO E DISPOSITIVO DE GERAÇÃO DE SINAIS DE COMANDO
DE UMA MAQUINA ELÉTRICA GIRATÓRIA POLIFÁSICA E SEQÜÊNCIAS DE
RPI 2109 de 07/06/2011
INSTRUÇÕES. O processo de acordo com a invenção é do tipo daqueles em
que os sinais (Swl, Sw2, Sw3) que comandam a alimentação (10) dos
enrolamentos (4) da máquina são constituídos por sinais defasados (So1, So2,
So3) de um ângulo de defasagem (p) continuamente variável em relação a
sinais de sincronização (Si1, Si2, Si3) produzidos pelos sensores (1) da posição
do rotor. De acordo com o processo, uma unidade de tratamento (5)
compreende entradas (8) que recebem os sinais de sincronização e saídas (6,
7) que emitem os ditos sinais defasados. Os sinais de sincronização são
sinaisbinários que apresentam frentes de sincronização e as frentes
ascendentes e descendentes dos sinais defasados são geradas depois de um
retardo de comutação de nível que é função de pelo menos o ângulo de
defasagem a partir de pelo menos uma frente de referência escolhida entre as
frentes de sincronização tal que o retardo é mínimo.
(71) Valeo Equipements Electriques Moteur (FR)
(72) Oussama Rouis
(74) Momsen, Leonardos & CIA.
(85) 28/08/2008
(86) PCT FR2007/051195 de 27/04/2007
(87) WO 2007/138203 de 06/12/2007
(21) PI 0708440-4 A2 (22) 05/03/2007
1.3
(30) 03/03/2006 GB 0604241.0
(51) H01M 8/04 (2006.01)
(54) CONJUNTO DE CÉLULA DE COMBUSTÍVEL ELETROQUÍMICA,
MÉTODO DE OPERAÇÃO DE UM CONJUNTO DE CÉLULA DE
COMBUSTÍVEL ELETROQUÍMICA, E, APARELHO
(57) CONJUNTO DE CÉLULA DE COMBUSTÍVEL ELETROQUÍMICA,
METODO DE OPERAÇÃO DE UM CONJUNTO DE CÉLULA DE
COMBUSTÍVEL ELETROQUÍMICA, E, APARELHO. Um ou mais parâmetros de
operação, tais como fluxo de corrente elétrica a partir de e fluxo de ar para, uma
pilha de células de combustível dentro de um conjunto de células de
combustível, são periodicamente modulados durante intervalos de rehidratação
para intermitentemente aumentar níveis de hidratação da pilha de células de
combustível independentemente da demanda de corrente elétrica sobre o
conjunto de célula de combustível a partir de uma carga externa, enquanto
mantém fornecimento de corrente elétrica para aquela carga externa.
(71) Intelligent Energy Limited (GB)
(72) Damian Davies, Nathan Grange, Paul Alan Benson
(74) Momsen, Leonardos & CIA.
(85) 01/09/2008
(86) PCT GB2007/000760 de 05/03/2007
(87) WO 2007/099360 de 07/09/2007
(21) PI 0708441-2 A2 (22) 06/03/2007
1.3
(30) 08/03/2006 GB 0604671.8
(51) G05F 1/14 (2006.01), H01F 29/04 (2006.01), H01H 9/00 (2006.01)
(54) MODIFICADOR DE DERIVAÇÃO EM CARGA HÍBRIDO, E, MÉTODO DE
OPERAÇÃO DO MESMO
(57) MODIFICADOR DE DERIVAÇÃO EM CARGA HÍBRIDO, E, METODO DE
OPERAÇÃO DO MESMO. Um modificador de derivação em carga híbrido (70),
para uso transmissão de energia de corrente alternada de alta tensão,
compreende um seletor (72) e um desviador (74) tendo duas pernas (80, 82)
definindo respectivos percursos de corrente. Cada perna (80, 82) inclui um par
(P 1, P2) de primeiro e segundo comutadores semicondutores opostos (84, 86).
O modificador de derivação em carga híbrido (70) também inclui um controlador
(76) configurado para comutar para um do primeiro ou segundo comutadores
semicondutores (84, 86) de uma dada perna (80, 82) em um ponto
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 57
predeterminado dentro do ciclo de corrente alternada de modo a comutar para
desligamento um desejado comutador semicondutor (84, 86) na outra perna
(80, 82).
(71) Areva T&D SA (FR)
(72) Donald Colin Murray Oates, Milan Saravolac
(74) Momsen, Leonardos & CIA.
(85) 01/09/2008
(86) PCT EP2007/052083 de 06/03/2007
(87) WO 2007/101849 de 13/09/2007
(21) PI 0708442-0 A2 (22) 28/02/2007
1.3
(30) 02/03/2006 DE 10 2006 010 268.1
(51) B62D 3/12 (2006.01), B62D 5/04 (2006.01), F16H 57/02 (2006.01)
(54) ENGRENAGEM DE RODA HELICOIDAL PARA GUIA DE CREMALHEIRA
(57) ENGRENAGEM DE RODA HELICOIDAL PARA GUIA DE CREMALHEIRA.
A presente invenção refere-se a uma engrenagem de roda helicoidal para uma
direção de cremalheira. A engrenagem de roda helicoidal consiste em um
pinhão (1), que se engrena com uma cremalheira no lado da saída de
movimento e uma roda helicoidal (2, 3, 4), disposta à prova de torção sobre o
pinhão (1), no lado do acionamento, na qual atua um torque provocado por uma
força de direção e/ou uma força de direção auxiliar. A roda helicoidal (2, 3, 4) é
formada como roda dentada montada, consiste em uma coroa dentada (2), que,
com relação à direção axial da engrenagem ou de seu pinhão (1), está disposta
entre dois flanges (3, 4). Nesse caso, a coroa dentada (2) está inserida sobre
um cubo (5) formado em um dos flanges (3) e se une com os flanges (3, 4) em
uma união por encaixe positivo. Diver-gindo do estado da técnica, de acordo
com a invenção nem todos os componentes que formam a roda helicoidal
construída estão inseridas apenas em ajuste por pressão sobre o pinhão (1).
Mais precisamente, um dos flanges (3), a saber, o flange (3) que apresenta o
cubo (5) para a coroa dentada (2), está formado em peça única com o pinhão
(1).
(71) ZF Friedrichshafen AG (DE)
(72) Olaf Beutler, Waldemar Rogowski, Remt Blankenspeck, Günter Lohfink
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT DE2007/000373 de 28/02/2007
(87) WO 2007/098744 de 07/09/2007
(21) PI 0708443-9 A2 (22) 01/03/2007
1.3
(30) 01/03/2006 US 60/777,970
(51) C08L 23/18 (2006.01), C08L 67/06 (2006.01), C08L 19/00 (2006.01), C08F
8/00 (2006.01), C08F 36/02 (2006.01), C08G 61/08 (2006.01)
(54) COMPOSIÇÕES POLIMÉRICAS CONTENDO POLÍMEROS OBTIDOS
POR METÁTESE COM CORES RECICLADAS REDUZIDAS
(57) COMPOSIÇÕES POLIMÉRICAS CONTENDO POLIMEROS OBTIDOS
POR METÁTESE COM CORES RECICLADAS REDUZIDAS. A presente
invenção refere-se a composições de poliéster aromático, tal como, PET, que
compreende um polímero insaturado preparado via polimerização por metátese
que possui ao menos ou mais grupos funcionais terminais especificados.
(71) Firestone Polymers, LLC (US)
(72) Dan Graves, William Hergenrother, James H. Pawlow
58
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT US2007/005332 de 01/03/2007
(87) WO 2007/100891 de 07/09/2007
(21) PI 0708444-7 A2 (22) 28/02/2007
1.3
(30) 01/03/2006 JP 2006-054861
(51) C23C 22/48 (2006.01), B05D 3/10 (2006.01), C09D 139/00 (2006.01),
C09D 175/04 (2006.01), C09D 183/08 (2006.01), C25D 9/10 (2006.01)
(54) COMPOSIÇÃO PARA TRATAMENTO DE SUPERFÍCIE DE METAL,
MÉTODO PARA TRATAMENTO DE SUPERFÍCIE DE METAL E MATERIAL
DE METAL
(57) COMPOSIÇÃO PARA TRATAMENTO DE SUPERFÍCIE DE METAL,
MÉTODO PARA TRATAMENTO DE SUPERFÍCIE DE METAL E MATERIAL
DE METAL. A presente invenção refere-se a uma composição facilmente
manipulável para tratamento de superfície de metal a qual permite obter
encobrimento da superfície de função, adesão de revestimento e resistência à
corrosão igual a ou superior àqueles obtidos através de composições para
tratamento de superfície de metal convencionais. Essa composição para
tratamento de superfície de metal não coloca carga sobre o ambiente. Também
é descrito um método para tratamento da superfície de um material de metal,
em que tal composição para tratamento de superfície de metal é usada, e um
material de metal tratado através de tal método para tratamento de superfície
de metal. Especificamente é descrita uma composição para tratamento de
superfície de metal usada para o tratamento de uma superfície de metal,
composição a qual contém um composto de zircônio e/ou um composto de
titânio substancialmente não contendo flúor e um ácido inorgânico e/ou um sal
do mesmo. Essa composição para tratamento de superfície de metal tem um
pH de não menos do que 1,5, mas não mais do que 6,5.
(71) Chemetall GMBH (DE)
(72) Toshio Inbe, Thomas Kolberg
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT JP2007/053832 de 28/02/2007
(87) WO 2007/100018 de 07/09/2007
(21) PI 0708445-5 A2 (22) 16/02/2007
1.3
(30) 17/02/2006 FR 0601462
(51) A61F 5/00 (2006.01)
(54) BALÃO INTRAGÁSTRICO COM MEMÓRIA DE FORMA
(57) BALÃO INTRAGÁSTRICO COM MEMÓRIA DE FORMA. A invenção se
refere a um balão intragástrico (1) expansível destinado a ser implantado,
depois retirado do estômago (2) de um paciente pelas vias naturais no quadro
de um tratamento de obesidade, o dito balão intragástrico (1) compreendendo
um envelope externo (3) suficientemente flexível para passar de uma primeira
configuração, dita configuração de introdução, para uma segunda configuração,
dita configuração expandida, na qual o balão apresenta sua forma funcional, o
dito balão (1) sendo caracterizado por compreender meios de acionar a
configuração de extração (10) capazes de exercer sobre o dito balão
intragástrico (1) uma tensão para fazê-lo passar da dita configuração expandida
para uma terceira configuração contraída de volume inferior, dita configuração
de extração, que age sobre o envelope externo (3) de modo que o dito envelope
externo (3) retorna, ou tende a, uma forma predeterminada correspondente à
dita configuração de extração.
(71) Compagnie Europeene D'Etude Et de Recherche de Dispositifs Pour
L'Implantantion Par Laparoscopie (FR)
(72) Pascal Paganon
(74) Araripe & Associados
(85) 18/08/2008
(86) PCT FR2007/000285 de 16/02/2007
(87) WO 2007/093717 de 23/08/2007
RPI 2109 de 07/06/2011
(21) PI 0708446-3 A2 (22) 23/02/2007
1.3
(30) 01/03/2006 US 60/778,516
(51) A61K 45/00 (2006.01), A61K 38/21 (2006.01), A01N 63/00 (2006.01)
(54) TRATAMENTO DE CÂNCER COMBINANDO AGENTE DE
LINFODEPLEÇÃO COM CTLS E CITOCINAS
(57) TRATAMENTO DE CÂNCER COMBINANDO AGENTE DE
LINFODEPLEÇÃO COM CTLs E CITOCINAS. A presente invenção refere-se a
um tratamento de câncer combinando terapia celular com quimioterapia, células
T CD8+ autôlogas que são obtidas de um paciente, ativadas ex vivo através de
contato delas com células apresentando antígeno xenogênicas carregadas com
antígeno de peptideo selecionado, deste modo gerando linfócitos T citotóxicos
ativados específicos de antígeno. Tais CTLs ativados são administrados ao
paciente em conjunto com um regime de linfodepleção e manutenção de CTL
compreendendo um agente náo-mieoablativo, mas de linfodepleção, tal como
cladribina ou denileucina diftitox, e citocinas estimuladoras interleucina-2 e
interferon-º-2b.
(71) Janssen Pharmaceutica N.V. (BE)
(72) Zeling Cai, Ann Moriarty, Per A. Peterson, Jon M. Richards
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT US2007/004841 de 23/02/2007
(87) WO 2007/103009 de 13/09/2007
(21) PI 0708447-1 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 US 60/778,199
(51) A61B 5/103 (2006.01)
(54) MÉTODO DE DEMONSTRAÇÃO DE ESPINHAS PRÉ-EMERGENTES
(57) MÉTODO DE DEMONSTRAÇÃO DE ESPINHAS PRÉ-EMERGENTES.
Um método para demonstrar espinhas pré-emergentes é descrito. O método
inclui o fornecimento de uma câmera possuindo uma lente macro de 25 mm e
um filtro de polarização incluindo de 10 a 50 filtros de banda estreita na faixa
espectral de 400 a 970 nm, e uma fonte de luz possuindo um polarizador linear
orientado verticalmente com relação a um plano de polarização do polarizador
de câmera, obtendo uma seqúência de imagens da face de um sujeito com a
câmera; criando um mapa de eritema da área de imagem reproduzida utilizando
valores de áxi-hemoglobina em cada pixel correspondente; obtendo uma
imagem de luz visível da face do sujeito; e comparando as imagens para se ver
as espinhas pré-emergentes. O método permite que consumidores vejam as
espinhas pré-emergentes e tratem as mesmas, o que resulta na prevenção de
espinhas ou na redução do surgimento das espinhas.
(71) Johnson & Johnson Consumer Companies, INC. (US)
(72) Nikiforos Kollias, Georgios N. Stamatas
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT US2007/063191 de 02/03/2007
(87) WO 2007/103795 de 13/09/2007
(21) PI 0708448-0 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 JP 2006-055706; 02/03/2006 JP 2006-055711
(51) A61K 31/55 (2006.01), A61P 27/02 (2006.01), A61P 27/16 (2006.01), A61P
37/08 (2006.01), C07D 487/04 (2006.01)
(54) COMPOSIÇÃO FARMACÊUTICA, MÉTODO PARA A PROFILAXIA OU
TRATAMENTO DE DOENÇAS OFTÁLMICAS ALÉRGICAS OU DOENÇAS
NASAIS ALÉRGICAS, E, USO DE UM COMPOSTO
(57) COMPOSIÇÃO FARMACÊUTICA, METODO PARA A PROFILAXIA OU
TRATAMENTO DE DOENÇAS OFTALMICAS ALÉRGICAS OU DOENÇAS
NASAIS ALÉRGICAS, E, USO DE UM COMPOSTO. A presente invenção
fornece uma composição farmacêutica para uso na profilaxia ou tratamento de
doenças oftálmicas alérgicas ou doenças nasais alérgicas, que compreende
7,8-dimetóxi-4(5H), 10-dioxo-1H-1,2,3-triazolo[4,5-c] [1]benzoazepina, 2-(1isopropoxicarbonilóxi-2-metilpropil)-7,8-dimetóxi-4(5H),10-dioxo2H-1,2,3triazolo [4,5-c][1]benzazepina ou um seu sal farmaceuticamente aceitável. A
composição farmacêutica de acordo com a presente invenção tem poucos
efeitos colaterais, exerce fortes efeitos profiláticos e terapêuticos na fase tardia,
exibindo resistência farmacêutica a instilações convencionais e pode ser usada
apropriadamente para aplicações tópicas.
(71) Meiji Seika Kaisha, LTD. (JP)
(72) Takashi Shishikura, Funcionário da Meiji Seika Kaisha, LTD, Tsuneyoshi
Inaba, Yukari Hoshina, Hirotomo Akabane, Mitsuhiro Uchida
(74) Momsen, Leonardos & CIA.
(85) 01/09/2008
(86) PCT JP2007/054008 de 02/03/2007
(87) WO 2007/100079 de 07/09/2007
(21) PI 0708449-8 A2 (22) 30/01/2007
1.3
(30) 02/03/2006 US 60/778512
(51) G06G 7/48 (2006.01)
(54) MÉTODOS PARA PRODUÇÃO DE HIDROCARBONETOS E PARA
AVALIAR UM MODELO DE RESERVATÓRIO, SISTEMA ASSOCIADO COM A
PRODUÇÃO DE HIDROCARBONETOS, E, MÉTODO PARA AVALIAR UM
MODELO DE RESERVATÓRIO
(57) METODOS PARA PRODUÇÃO DE HIDROCARBONETOS E PARA
AVALIAR UM MODELO DE RESERVATÓRIO, SISTEMA ASSOCIADO COM A
PRODUÇÃO DE HIDROCARBONETOS, E, METODO PARA AVALIAR UM
MODELO DE RESERVATÓRIO. O presente pedido descreve um método e
sistema associado à produção de hidrocarbonetos. No método, modelos de
tempo de escoamento de fluido são elaborados a partir de um modelo de
reservatório. Depois, medidas de conectividade de reservatório são calculadas
a partir de modelos de tempo de escoamento de fluido e analisadas para
RPI 2109 de 07/06/2011
determinar uma localização para pelo menos um poço. Com base na análise,
um ou mais poços podem ser perfurados e hidrocarbonetos produzidos.
(71) Exxonmobil Upstream Research Company (US)
(72) Dachang Li, Xiao-Hui Wu, Tao Sun, Frank J. Goulding, Robert M. Stuart,
Timothy A. Chartrand, Cory J. Ramage
(74) Momsen, Leonardos & CIA.
(85) 01/09/2008
(86) PCT US2007/002351 de 30/01/2007
(87) WO 2007/106244 de 20/09/2007
(21) PI 0708450-1 A2 (22) 13/02/2007
1.3
(30) 14/02/2006 FR 0650528
(51) F27B 5/16 (2006.01), C21D 9/00 (2006.01)
(54) DISPOSITIVO DE VEDAÇÃO PARA ENTRADA DE GÁS NUM FORNO OU
CONGÊNERES
(57) DISPOSITIVO DE VEDAÇÃO PARA ENTRADA DE GÁS NUM FORNO OU
CONGÊNERES. Uma tubulação (12) para alimentar um gás dentro de um
forno, uma lareira, ou similares (tais como um forno IVQ/DVQ), e em particular
numa estrutura de câmara de reação (16) dentro do forno, é provida com um
dispositivo de vedação tubular (32) estanque a vazamento de gás que se
estende radialmente por fora da tubulação e que define um caminho que é
praticamente estanque a vazamento de gás, ao longo do qual se estende a tal
tubulação de alimentação, O dispositivo de vedação tubular (32) é
preferivelmente pelo menos parcialmente flexível na direção transversal e/ou
direção axial de modo a acomodar problemas de posicionamento entre um local
situado na câmara de reação (16) e um local onde a tubulação de alimentação
de gás penetra no forno (cujos problemas podem ser devidos, por exemplo, a
expansão/contração térmica assimétrica).
(71) Messier-Bugatti (FR)
(72) Jean-Michel Garcia, Olivier Petitjean, Eric Sion
(74) Araripe & Associados
(85) 14/08/2008
(86) PCT EP2007/051369 de 13/02/2007
(87) WO 2007/093584 de 23/08/2007
(21) PI 0708451-0 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 GB 0604236.0
(51) C07D 251/48 (2006.01), B01J 20/22 (2006.01)
(54) ADSORVENTES PARA PURIFICAÇÃO DE PROTEÍNAS
(57) ADSORVENTES PARA PURIFICAÇAO DE PROTEÍNA. Uso de um
adsorvente de afinidade para separação, remoção, isolamento, purificação,
caracterização, identificação ou quantificação de um material proteináceo, em
que o adsorvente de afinidade é um composto da fórmula (III) em que R1 é H,
alquila, arila, hidroxialquila, ciclohexila, amino ou um grupo heterocíclico, que é
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 59
opcionalmente substituído com um ou mais entre alquila, arila, alcóxi, arilóxi,
acilóxi, acilamino, amino, OH, CO2H, sulfonila, carbamonila, sulfamoíla,
alquilsulfonila e halogênio; um X é N e o outro é N, C-Cl ou C-CN; Y é O, S ou
NR2; Z é O, S ou NR3; R2 e R3 são cada um H, alquila, hidroxialquila, benzila ou
ß-feniletila; Q é benzeno, naftaleno, benzotiazol, benzoxazol, 1-fenilpirazol,
indazol ou benzimidazol; R4, R5 e R6 são cada um H, OH, alquíla, arila,
heterocíclico, alcóxi, arílóxi, amíno, acilóxi, acílamino, CO2H, ácido sulfônico,
carbamoila, sulfamoila, alquilsulfonila ou halogênio, ou dois ou mais de R4, R5 e
R6 são ligados para formar uma estxctura cíclica; U e V são grupos alquileno de
cadeia reta C1-10 iguais ou diferentes, opcíonalmente substituidos por um ou
mais entre hidroxíla, alquíla, arila, hidroxialquila, ß-feniletiia e halogênio; e A é
uma matriz de suporte opcíonaimente ligada ao anel contendo X por um
espaçador.
(71) Prometic Biosciences Ltd. (GB)
(72) Jason Richard Betley, Helen Tatton, Kelly Le Riche, Matthew Webb
(74) Montaury Pimenta, Machado & LIoce
(85) 01/09/2008
(86) PCT GB2007/050095 de 02/03/2007
(87) WO 2007/099374 de 07/09/2007
(21) PI 0708452-8 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 US 11/368,260
(51) G06F 15/00 (2006.01)
(54) MÉTODO E APARELHO DE CORREÇÃO DE DISTORÇÃO BASEADO EM
MODELO
(57) MÉTODO E APARELHO DE CORREÇÃO DE DISTORÇÃO BASEADO EM
MODELO. A invenção refere-se a um aparelho e método para processar uma
imagem capturada e, mais especificamente, para processar uma imagem
capturada que compreende um documento. Em uma modalidade, um aparelho
compreende uma câmera para capturar os documentos está descrito. Em outra
modalidade, um método para processar uma imagem capturada que inclui um
documento compreende as etapas de distinguir um documento de imagem
formada de seu fundo, ajustar a imagem capturada para reduzir as distorções
criadas pela utilização de uma câmera e orientar apropriadamente o
documento.
(71) Compulink Management Center, Inc. (US)
(72) Minghui Wu, Rongfeng Li, Wenxin Li, Edward P. Heaney, Karl Chan, Kurt
A. Rapelje
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT US2007/005492 de 02/03/2007
(87) WO 2007/103251 de 13/09/2007
(21) PI 0708453-6 A2 (22) 01/03/2007
1.3
(30) 01/03/2006 GB 06 04131.3
(51) F16H 25/20 (2006.01)
(54) ATUADOR TOLERANTE A EMPERRAMENTO
(57) ATUADOR TOLERANTE A EMPERRAMENTO. A presente invenção
refere-se a um atuador (2) que compreende o primeiro e o segundo dispositivos
de movimento linear, cada um apto a estender o atuador (2) e disposto de modo
que o emperramento de um dentre o primeiro ou o segundo dispositivos de
movimento linear não impeça a operação do outro. O primeiro dispositivo de
movimento linear compreende um primeiro parafuso linear (10), uma primeira
porca (12), e uma primeira força motriz primária (14), disposta para conceder
movimento linear relativo entre o parafuso e a porca. De forma similar, o
60
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
segundo dispositivo de movimento linear compreende um segundo parafuso
linear (20), uma segunda porca (22), e uma segunda força motriz primária (24)
disposta para conceder movimento linear relativo entre o segundo parafuso e a
porca. O primeiro parafuso linear (10) pode ter um furo (18) no qual o segundo
parafuso linear (20) é acomodado quando o atuador (2) está na posição
retraida.
(71) Airbus Uk Limited (GB)
(72) Arnaud Didey, Nicholas Elliott
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT GB2007/000726 de 01/03/2007
(87) WO 2007/099333 de 07/09/2007
(21) PI 0708454-4 A2 (22) 26/02/2007
1.3
(30) 02/03/2006 AT A 354/2006; 01/09/2006 AT A 1458/2006
(51) H01H 71/02 (2006.01), H01H 71/06 (2006.01)
(54) DISPOSITIVO DE COMUTAÇÃO
(57) DISPOSITIVO DE COMUTAÇÃO. A presente invenção refere-se a um
dispositivo de comutação (1), especialmente um interruptor de linha e/ou um
interruptor de corrente residual que tem um alojamento (2) e tendo contatos de
comutação para fechamento e/ou abertura de pelo menos um circuito, no qual
um aparelho de desengate para automaticamente desconectar os contatos de
comutação é previsto, no qual o alojamento (2) tem pelo menos um lado frontal
(3), a invenção propõe, para a finalidade de satisfazer requisitos variáveis do
mercado ou dos clientes de forma rápida, flexível e a um custo favorável,
encaixar uma tampa de cobertura (4) sobre o lado frontal (3).
(71) Moeller Gebäudeautomation Gmbh (AT)
(72) Ernst Hammermayer
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 01/09/2008
(86) PCT AT2007/000098 de 26/02/2007
(87) WO 2007/098516 de 07/09/2007
(21) PI 0708558-3 A2 (22) 21/03/2007
(30) 02/04/2006 IL 174722
(51) B23B 31/20 (2006.01)
(54) CONJUNTO DE FERRAMENTA DE CORTE
1.3
RPI 2109 de 07/06/2011
(57) CONJUNTO DE FERRAMENTA DE CORTE. Um mandril e um artigo são
configurados de tal modo que o artigo é fixado de maneira liberável no mandril.
Um dentre o mandril e o artigo é dotado de uma crista e o outro com uma calha.
Quando o artigo é fixado ao mandril a crista penetra na calha, de modo a ajudar
a impedir o deslizamento de um em relação ao outro. O mandril pode incluir um
receptor que tem um furo afunilado, um colar que tem uma superficie externa
afunilada de maneira complementar, e uma porca configurada para ser fixada
em rosqueamento a uma extremidade dianteira do receptor; o artigo pode ser
uma espiga tal como uma espiga de ferramenta. Uma superficie interna do colar
pode ser dotada de uma crista que é configurada para ajustar no interior de
uma calha formada na espiga. Em uma posição fixada, a espiga é acomodada
no furo do colar, com a crista do colar ocupando, no mínimo parcialmente, a
calha da espiga, com isto impedindo movimento da espiga em relação ao colar,
a qual, ele própria, é acomodada no furo do receptor.
(71) Iscar LTD. (IL)
(72) Hanoch Guy
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT IL2007/000367 de 21/03/2007
(87) WO 2007/113797 de 11/10/2007
(21) PI 0708559-1 A2 (22) 02/02/2007
1.3
(30) 06/03/2006 US 60/779680
(51) F16H 37/06 (2006.01), F16H 47/00 (2006.01), F02C 3/00 (2006.01), F02G
3/00 (2006.01), F16D 33/00 (2006.01)
(54) CADEIA DE EQUIPAMENTO MOTORIZADO ROTATIVO, CONVERSOR
DE TORQUE DE PARTIDA POR COMPRESSOR, MÉTODO PARA INICIAR
PELO MENOS UM COMPRESSOR EM UMA CADEIA DE EQUIPAMENTO
MOTORIZADO ROTATIVO, E, MÉTODO PARA FABRICAR GNL
(57) CADEIA DE EQUIPAMENTO MOTORIZADO ROTATIVO, CONVERSOR
DE TORQUE DE PARTIDA POR COMPRESSOR, METODO PARA INICIAR
PELO MENOS UM COMPRESSOR EM UMA CADEIA DE EQUIPAMENTO
MOTORIZADO ROTATIVO, E, METODO PARA FABRICAR GNL. Um método e
um aparelho de conversor de torque de partida por compressor para cadeias de
equipamento motorizado rotativo inclui um conversor de torque de partida por
compressor (CSTC) e engrenagem para fazer a velocidade de entrada e saída
se conformar às exigências de velocidade e potência do pelo menos um
compressor na extremidade da coluna. A coluna também inclui uma máquina
motriz, uma turbina igualmente de motor ou de gás com um motor de partida. O
CSTC é acionado por uma máquina motriz que foi engrenada a uma velocidade
apropriada para transferência de potência eficiente, seguida por uma unidade
de aumento de engrenagem para permitir a aumento de velocidade da saída do
CSTC se conformar às exigências necessárias de um compressor de alta
velocidade. A engrenagem pode ser de duas unidades separadas com seus
próprios alojamentos, ou incorporada em um alojamento unitário com o CSTC.
O CSTC pode ser um CSTC usado em partidas pressurizadas das colunas de
carga de compressor alta para serviço de refrigeração de GNL.
(71) Exxonmobil Upstream Research Company (US)
(72) Christopher G. Holt, William L. Martin
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT US2007/003019 de 02/02/2007
(87) WO 2007/102964 de 13/09/2007
(21) PI 0708560-5 A2 (22) 21/03/2007
1.3
(30) 22/03/2006 GB 0605766.5
(51) C07D 213/24 (2006.01), C07D 417/04 (2006.01)
(54) PROCESSO PARA A PREPARAÇÃO DE UM COMPOSTO, E,
COMPOSTO
(57) PROCESSO PARA A PREPARAÇÃO DE UM COMIPOSTO, E,
COMPOSTO. Um processo para preparar derivados de 1-Halo-2,7-nafliridinila é
descrito (1), em que X é Cl ou Br; processo este que compreende as etapas
seguintes: (i) reação de um derivado de 3-ciano-4-metilpiridina da fórmula (A):
com um composto da fórmula (II), na presença de um N,N-dimetilformamida
dialquilacetal C16; para fornecer um derivado de enamina da fórmula (III), (ii)
ciclização da enamina da fórmula (III), para obter o composto da fórmula (IV),
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 61
(iii) reação do composto da fórmula (IV) com um agente de halogenação, para
obter um composto da fórmula (I).
(71) UCB Pharma S.A. (BE)
(72) Nicholas David Tyrrell, Neil Tremayne, Graham Robert Evans
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT EP2007/002485 de 21/03/2007
(87) WO 2007/107345 de 27/09/2007
(21) PI 0708561-3 A2 (22) 06/03/2007
1.3
(30) 09/03/2006 US 60/781144; 11/04/2006 US 60/791236
(51) C12N 15/74 (2006.01)
(54) PREPARAÇÃO FARMACÊUTICA, E MÉTODOS DE TRATAMENTO DE
UM INDIVÍDUO QUE SOFRE DE UM DISTÚRBIO ANAL, E DE AVALIAÇÃO
DA EFICÁCIA DE UM TRATAMENTO DE DISTÚRBIO ANAL EM UM
INDIVÍDUO, MONITORAMENTO DO PROGRESSO DE UM INDIVÍDUO
SENDO TRATADO PARA UM DISTÚRBIO ANAL, OU UM MÉTODO DE
SELEÇÃO DE UM INDIVÍDUO PARA O TRATAMENTO DE DISTÚRBIO ANAL
(57) PREPARAÇÃO FARMACÊUTICA, E METODOS DE TRATAMENTO DE
UM INDIVÍDUO QUE SOFRE DE UM DISTÚRBIO ANAL, E DE AVALIAÇÃO
DA EFICÁCIA DE UM TRATAMENTO DE DISTÚRBIO ANAL EM UM
INDIVÍDUO, MONITORAMENTO DO PROGRESSO DE UM INDIVÍDUO
SENDO TRATADO PARA UM DISTÚRBIO ANAL, OU UM MÉTODO DE
SELEÇÃO DE UM INDIVÍDUO PARA O TRATAMENTO DE UM DISTÚRBIO
ANAL. A presente invenção diz respeito às composições e métodos para o
tratamento de distúrbios do reto.
(71) Salix Pharmaceuticals, Inc. (US)
(72) Alan Safdi, David Taylor
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT US2007/005846 de 06/03/2007
(87) WO 2007/103448 de 13/09/2007
(21) PI 0708562-1 A2 (22) 05/03/2007
1.3
(30) 07/03/2006 US 60/779939
(51) A61K 47/48 (2006.01), A61P 37/06 (2006.01)
(54) PROCESSOS PARA PREPARAR CONJUGADOS DE POLIETILENO
GLICOR DE MACROLÍDEOS IMUNOSSUPRESSORES, UM MACROLÍDEO
IMUNOSSUPRESSOR PEGUILADO, UMA RAPAMICINA PEGUILADA, UM
EVEROLIMUS PEGUILADO, UM CCI-779 PEGUILADO E UM TACROLIMUS
PEGUILADO, E, PRODUTO
(57) PROCESSOS PARA PREPARAR CONJUGADOS DE POLIETILENO
GLICOL DE MACROLÍDEOS IMUNOSSUPRESSORES, UM MACROLÍDEO
IMUNOSSUPRESSOR PEGUILADO, UMA RAPAMILCINA PEGUILADA, UM
EVEROLIMUS PEGUILADO, UM CCI-779 PEGUILADO E UM TACROLIMUS
PEGUILADO, E, PRODUTO. São descritos processos para preparação de
rapamicinas 42-peguiladas incluindo reação de uma rapamicina com um agente
de acilação na presença de uma lipase para formar uma rapamicina acuada e
reação da rapamicina acuada com um derivado de metóxi-(polietileno glicol) na
presença de uma base. Também são descritos processos para preparação de
ascomicina e/ou tacrolimus 32-peguilado(a) usando estas etapas.
(71) WYETH (US)
(72) Jianxin Gu, Mark Ruppen, Tianmin Zhu, Mahdi Fawzi
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT US2007/005646 de 05/03/2007
(87) WO 2007/103348 de 13/09/2007
(21) PI 0708563-0 A2 (22) 02/03/2007
1.3
(30) 06/03/2006 JP 2006-058897; 06/03/2006 JP 2006-058898
(51) H02K 13/00 (2006.01), C04B 37/02 (2006.01), C04B 41/88 (2006.01),
H02K 15/02 (2006.01)
(54) MÉTODO PARA PRODUZIR UM COMUTADOR DE CARBONO
UTILIZANDO UM MATERIAL BASE COMPÓSITO DE CARBONO, E,
COMUTADOR DE CARBONO UTILIZANDO UM MATERIAL BASE
COMPÓSITO DE CARBONO
(57) MÉTODO PARA PRODUZIR UM COMUTADOR DE CARBONO
UTILIZANDO UM MATERIAL BASE COMPÓSITO DE CARBONO, E,
COMUTADOR DE CARBONO UTILIZANDO UM MATERIAL BASE
COMPOSITO DE CARBONO. Na produção de uma base de compósito de
carbono (11) compreendendo uma base de carbono (14) e, formada na sua
superficie, uma camada de ferro (15) na qual um material metálico pode ser
ligado, a resistência ao desprendimento entre a base de carbono (14) e a
camada de ferro (15) é aumentada. Uma base de compósito de carbono (11) é
formada aderindo-se um pó de ferro a uma superficie de uma base de carbono
(14) formada antecipadamente por sinterização e então sinterizando o pó de
ferro aderente a uma temperatura que não é inferior à temperatura de difusão
do carbono e não é superior ao ponto de fusão do ferro. O pó de ferro a ser
usado é um que foi tratado de maneira a ter um maior teor de oxigénio
adsorvido na sua superfície, submetendo-o a imersão em água, ou a tratamento
térmico. Assim, a resistência ao desprendimento é aumentada.
(71) Mitsuba Corporation (JP)
(72) Hiroaki Tanaka, Hiroyuki Takayanagi, Seiji Otake, Mitsunari Ishizaki
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT JP2007/054009 de 02/03/2007
(87) WO 2007/102417 de 13/09/2007
(21) PI 0708564-8 A2 (22) 02/03/2007
1.3
(30) 07/03/2006 FR 0602011
(51) C07C 69/34 (2006.01), C07C 67/22 (2006.01), C08K 5/11 (2006.01)
(54) COMPOSIÇÃO, PROCESSO DE FABRICAÇÃO DE UMA COMPOSIÇÃO
DE DIÉSTERES E UTILIZAÇÃO DE UMA COMPOSIÇÃO
(57) COMPOSIÇÃO, PROCESSO DE FABRICAÇÃO DE UMA COMPOSIÇÃO
DE DIÉSTERES E UTILIZAÇÃO DE UMA COMPOSIÇÃO. A presente invenção
trata de diésteres de ácidos carboxílicos apresentando notadamente
propriedades de solvatação interessantes e podendo ser utilizados em
substituição a solventes usuais notadamente halogenados. A invenção trata
mais particularmente de uma composição de diésteres de ácidos carboxílicos
ramificados obtidos a partir de uma mistura de dinitrilas ramificadas e sua
utilização como solvente em numerosas aplicações industriais.
(71) Rhodia Operations (FR)
(72) Philippe Marion, Lise Trouillet-Fonti, Jean-Marie Bernard
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT ER2007/000370 de 02/03/2007
(87) WO 2007/101929 de 13/09/2007
(21) PI 0708565-6 A2 (22) 13/02/2007
1.3
(30) 06/03/2006 US 60/779679
(51) E21B 21/01 (2006.01), E21B 21/06 (2006.01), E21B 21/08 (2006.01)
(54) SISTEMA E MÉTODO PARA PERFURAR EM FURO DE POÇO, E,
MÉTODO ASSOCIADO À PRODUÇÃO DE HIDROCARBONETOS
(57) SISTEMA E METODO PARA PERFURAR UM FURO DE POÇO, E,
METODO ASSOCIADO À PRODUÇÃO DE HIDROCARBONETOS. Um método
e sistema para perfurar um poço são descritos. O sistema inclui um furo de
poço com uma lama de perfuração de densidade variável, um conjunto de furo
de fundo disposto no furo de poço e uma unidade de processamento de lama
de perfuração em comunicação fluídica com o furo de poço. A lama de
perfuração de densidade variável tem partículas compressíveis e fluido de
perfuração. O conjunto de furo de fundo é acoplado à tubulação de perfuração,
enquanto a unidade de processamento de lama de perfuração é configurada
para separar as partículas compressíveis da lama de perfuração de densidade
variável. As partículas compressiveis neste modo de realização podem incluir
objetos ocos compressíveis carregados com gás pressurizado e configurados
para manter o peso da lama entre o gradiente de pressão de fratura e o
gradiente de pressão nos poros. Em adição, o sistema e o método também
podem gerenciar o uso de partículas compressiveis tendo características
diferentes, como tamanho, durante operações de perfuração.
(71) Exxonmobil Upstream Research Company (US)
(72) P. Matthew Spiecker, Pavlin B. Entchev, Remesh Gupta, Richard Polizzotti,
Barbara Carstensen, Dennis G. Peiffer, Norman Pokutylowicz
(74) Momsen, Leonardos & CIA.
(85) 04/09/2008
(86) PCT US2007/003691 de 13/02/2007
(87) WO 2007/102971 de 13/09/2007
(21) PI 0708566-4 A2 (22) 07/03/2007
(30) 07/03/2006 US 60/780,391; 06/03/2007 US 11/682,858
1.3
62
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(51) H04Q 7/32 (2009.01), H04Q 7/38 (2009.01)
(54) SELEÇÃO DE REDE POR TERMINAIS SEM FIO
(57) SELEÇAO DE REDE POR TERMINAIS SEM FIO. São aqui descritas
técnicas para efetuar a seleção de rede de forma eficiente usando informações
armazenadas em um terminal. O terminal pode armazenar informações quanto
à cobertura para redes sem fio previamente acessadas, informações de célula
para redes sem fio previamente acessadas, informações quanto ao uso para
redes sem fio previamente acessadas, informações quanto à disponibilidade
para redes sem fio previamente acessadas, informações de almanaque para
células em redes sem fio (por exemplo, informações sobre células disponíveis
em diferentes locais e informações para captar as células), e/ou outras
informações que possam ser úteis para a seleção de rede. O terminal pode
selecionar uma rede sem fio para tentar a sua captação com base nas
informações sobre cobertura armazenadas e em sua posição atual, nas
informações de célula armazenadas e em informações para a posição atual (por
exemplo, uma identidade de uma célula detectada na posição atual), nas
informações de uso armazenadas, nas informações sobre disponibilidade
armazenadas e/ou nas informações de almanaque armazenadas.
(71) Qualcomm Incorporated (US)
(72) Stephen Edge, David Williams, Niels Peter Skov Andersen
(74) Montaury Pimenta, Machado & Lioce S/C Ltda
(85) 04/09/2008
(86) PCT US2007/063497 de 07/03/2007
(87) WO 2007/103975 de 13/09/2007
(21) PI 0708582-6 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 US 60/780,334; 07/03/2007 US 11/683,202
(51) F16J 15/36 (2006.01), F16J 15/34 (2006.01)
(54) VEDAÇÃO MECÂNICA COM ESTABILIDADE DE FACE ACENTUADA
(57) VEDAÇÃO MECÂNICA COM ESTABILIDADE DE FACE ACENTUADA. A
presente invenção refere-se a um conjunto de vedação para uso com um eixo
giratório. O conjunto de vedação compreende um anel de vedação, um
envoltório de anel de vedação e fole. O anel de vedação define uma superfície
anular que se estende axialmente e uma face de vedação que se estende
radialmente. O envoltório de anel de vedação tem uma peça frontal e uma peça
traseira presas juntas. A peça frontal inclui uma porção de pé definindo uma
superfície de encaixe que se estende axialmente para encaixe de ajuste de
interferência com a superfície anular do anel de vedação. A peça frontal ainda
inclui uma porção de canela que se estende radialmente, conectada à porção
de pé e localizada radialmente para fora da porção de pé. A porção de pé inclui
uma porção de pé interna que se estende axialmente da conexão da porção de
pé com a porção de canela. A porção de pé em sua superfície de encaixe tem
um comprimento axial. A porção de pé interna em sua superfície de encaixe
tem um comprimento axial. A porção de canela tem um comprimento axial, O
fole define um diâmetro efetivo em pressão zero aplicada sobre o anel de
vedação. A interface da porção de pé com o anel de vedação define um
diâmetro de interferência. É preferível que o comprimento axial da porção de pé
é maior do que o comprimento axial da porção de canela. Também é preferível
que a relação do comprimento axial da porção de pé interna em sua superfície
de encaixe para o comprimento axial da porção de pé em sua superfície de
encaixe é maior do que 0,5. Ainda é preferível que o diâmetro de interferência
esteja dentro de + 10% e - 10% do diâmetro efetivo do fole em pressão
diferencial de zero.
(71) John Crane INC. (US)
(72) Prithwish Basu, Davi P. Casucci
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT US2007/063576 de 08/03/2007
(87) WO 2007/104014 de 13/09/2007
RPI 2109 de 07/06/2011
(21) PI 0708586-9 A2 (22) 05/03/2007
1.3
(30) 06/03/2006 FR 06 01954
(51) C07D 277/68 (2006.01), A61K 31/428 (2006.01), A61P 3/04 (2006.01),
A61P 3/06 (2006.01), A61P 3/10 (2006.01)
(54) DERIVADOS HETEROCÍCLICOS CICLOALQUILAS, RESPECTIVO
PROCESSO DE PREPARO E COMPOSIÇÕES FARMACÊUTICAS QUE
CONTÊM
(57) DERIVADOS HETEROCICLICOS CICLOALQUILAS, RESPECTIVO
PROCESSO DE PREPARO E COMPOSIÇÕES FARMACÊUTICAS QUE OS
CONTÊM. Compostos de fórmula (I): na qual: - R1 representa um grupamento
cicloalquila (C3-C8); - R2 representa um grupamento de fórmula (II) tal como
definido na descrição; - X representa um átomo de oxigênio, ou um grupamento
N-OR', no qual R' representa um átomo de hidrogênio, um grupamento alquila
(C1-C6), linear ou ramificado, arila ou arilalquila (C1-C6), linear ou ramificado,
como agentes hipoglicemiantes e hipolipemiantes.
(71) Les Laboratoires Servier (FR)
(72) Aurélie Hurtevent, Jean-Martial L'Helgoual'Ch, Pascal Carato, Nicolas
Lebegue, Véronique Leclerc, Morgan Le Naour, Pascal Berthelot, Catherine
Dacquet, Alain Ktorza, Daniel Henri Caignard
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT FR2007/000384 de 05/03/2007
(87) WO WO2007/101935 de 13/09/2007
(21) PI 0708587-7 A2 (22) 19/02/2007
1.3
(30) 08/03/2006 US 11/276.620
(51) C08K 3/04 (2006.01), C08K 7/22 (2006.01), C08L 27/00 (2006.01), C08L
27/12 (2006.01)
(54) COMPÓSITOS DE POLÍMERO
(57) COMPÓSITOS DE POLÍMERO. A presente invenção refere-se a
composições que compreendem uma pluralidade de nanotubos de carbono, um
polímero hospedeiro e um copolímero de bloco que compreende um primeiro
bloco e um segundo bloco, sendo que não há bloco compatível com o polímero
hospedeiro. Em um aspecto, o copolímero de bloco é anfifílico. Em outro
aspecto, o copolímero de bloco pode compreender um primeiro bloco e um
segundo bloco, sendo que ao menos um dentre o primeiro e o segundo bloco
compreende unidades de repetição derivadas de um monômero com a seguinte
fórmula geral: (R) 2C=C(R)(Rf) sendo que Rf é selecionado a partir de flúor, um
grupo alquila fluorado ou perfluorado C1 a C10 e um grupo alcóxi fluorado ou
perfluorado C1 a C10; cada R é, independentemente, selecionado a partir de F,
H, Cl, Rf, um grupo alquila C1 a C1O e R2A, sendo que R2 é um grupo alquileno
C1 a C10 e A é selecionado a partir de CO2M e SO3M, sendo que M é
selecionado a partir de H, um grupo de organo de ônio e amônio.
(71) 3M Innovative Properties Company (US)
(72) James M. Nelson, Rayn E. Marx, John W. Longabach
(74) Alexandre Ferreira
(85) 05/09/2008
(86) PCT US2007/004295 de 19/02/2007
(87) WO WO2007/102980 de 13/09/2007
(21) PI 0708588-5 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 US 60/780.905; 29/09/2006 US 60/848.274
(51) A61K 48/00 (2006.01)
(54) APTÂMEROS DE LIGAÇAO AO COMPLEMENTO E AGENTES ANTI-C5
USADOS NO TRATAMENTO DE DESORDENS OCULARES
(57) APTÂMEROS DE LIGAÇÃO AO COMPLEMENTO E AGENTES ANTI-C5
USADOS NO TRATAMENTO DE DESORDENS OCULARES. São descritas
métodos de tratar desordens oculares mediadas pelo complemento
administrando agentes que inibem um componente do complemento do sujeito
em uma quantidade suficiente para na desordem ocular em que, em uma
RPI 2109 de 07/06/2011
modalidade selecionada, o dito agente é um aptâmero anti-complemento que,
em uma modalidade preferida, é um aptâmero anti-C5.
(71) Archemix Corp. (US)
(72) David Epstein, Jeff C. Kurz
(74) Alexandre Ferreira
(85) 05/09/2008
(86) PCT US2007/006020 de 08/03/2007
(87) WO WO2007/103549 de 13/09/2007
(21) PI 0708589-3 A2 (22) 05/03/2007
1.3
(30) 07/03/2006 GB 0604591.8
(51) A61J 1/14 (2006.01), B65D 51/20 (2006.01)
(54) FRASCO MEDICINAL, E, PROCESSO PARA MONTAR UMA
COMBINAÇÃO DE UM FRASCO E UM SISTEMA DE FECHO
(57) FRASCO MEDICINAL, E, PROCESSO PARA MONTAR UMA
COMBINAÇÃO DE UM FRASCO E UM SISTEMA DE FECHO. Frascos
medicinais são providos incorporando RFID's em uma maneira que causa com
que eles permaneçam associados com o frasco quando o fecho de frasco é
aberto. Várias formas de realização são expostas. Em uma forma de construção
preferida, um RFID é incorporado no sistema de fecho de frasco.
(71) GlaxoSmithkline Biologicals S.A. (BE)
(72) Jacques Thilly, Christian Vandecasserie
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT EP2007/052061 de 05/03/2007
(87) WO WO2007/101840 de 13/09/2007
(21) PI 0708590-7 A2 (22) 28/02/2007
1.3
(30) 08/03/2006 DE 102006011075.7
(51) C08B 15/02 (2006.01)
(54) PROCESSO PARA A DEGRADAÇÃO DE POLISSACARÍDEOS,
OLIGOSSACARÍDEOS OU DISSACARÍDEOS OU DERIVADOS DOS
MESMOS
(57) PROCESSO PARA A DEGRADAÇÃO DE POLISSACARIDEOS,
OLIGOSSACARIDEOS OU DISSACARIDEOS OU DERIVADOS DOS
MESMOS. A presente invenção descreve um processo para a degradação de
celulose através da dissolução da celulose em um líquido iônico e de seu
tratamento com um ácido, se apropriado com a adição de água.
(71) Basf SE (DE)
(72) Klemens Massonne, Giovanni D'andola, Veit Stegmann, Werner Mormann,
Markus Wezstein, Wei Leng
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT EP2007/051870 de 28/02/2007
(87) WO WO 2007/101811 de 13/09/2007
(21) PI 0708591-5 A2 (22) 28/02/2007
1.3
(30) 08/03/2006 EP 06110815.5
(51) C08G 69/26 (2006.01)
(54) COMPOSIÇÕES DE MOLDAGEM DE POLIAMIDA, USO DE
COMPOSIÇÕES DE MOLDAGEM DE POLIAMIDA, E, CORPO MOLDADO
(57) COMPOSIÇÕES DE MOLDAGEM DE POLIAMIDA, USO DE
COMPOSIÇÕES DE MOLDAGEM DE POLIAMIDA, E, CORPO MOLDADO.
Composições de moldagem de poliamida termoplásticas, semicristalinas,
semiaromáticas, que compreendem: A) de 40 a 100%, em peso, de uma
copoliamida composta de: a1) de 30 a 44 mol % de unidades que derivam do
ácido terefiálico; a2) de 6 a 20 mol % de unidades que derivam do ácido
isofiálico; a3) de 42 a 49,5 mol % de unidades que derivam de
hexametilenodiamina; a4) de 0,5 a 8 mol % de unidades que derivam de
diaminas aromáticas tendo de 6 a 30 átomos de carbono; em que os
percentuais molares dos componentes a1) e a4) fornecem, juntos, 100% e B)
de 0 a 50%, em peso, de uma carga fibrosa ou em partículas, C) de 0 a 30%,
em peso, de um polímero elastomérico, D) de 0 a 30%, em peso, de outros
aditivos e auxiliares de processamento, em que os percentuais, em peso, dos
componentes A) a D) fornecem, juntos, 100%.
(71) Basf SE (DE)
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 63
(72) Philippe Desbois, Gerd Blinne, Ralf Neuhaus, Hagen Stawitzki, HansJoachim Weis
(74) Momsen, Leonardos & Cia
(85) 05/09/2008
(86) PCT EP2007/051865 de 28/02/2007
(87) WO WO2007/101809 de 13/09/2007
(21) PI 0708592-3 A2 (22) 05/03/2007
1.3
(30) 06/03/2006 US 60/780045; 04/05/2006 US 60/797503
(51) A61K 9/20 (2006.01), A61K 9/16 (2006.01)
(54) FORMULAÇÃO FARMACÊUTICA, TABLETE, PROCESSO PARA
PEPARAR UM FORMULAÇÃO FARMACÊUTICA, PRODUTO, E, PROCESSO
PARA PRODUZIR UM TABLETE
(57) FORMULAÇÃO FARMACÊUTICA, TABLETE, PROCESSO PARA
PREPARAR UMA FORMULAÇÃO FARMACÊUTICA, PRODUTO, E,
PROCESSO PARA PRODUZIR UM TABLETE. A presente invenção é dirigida a
formulações farmacêuticas e composições de tabletes de agentes
farmacologicamente ativos de Fórmula (I), que são moduladores do receptor do
estrogênio, e processos preparativos para as mesmas.
(71) Wyeth (US)
(72) Rolland W. Carson, Mohamed Ghorab, Shamim Hasan, Shailesh K. Singh,
Arwinder S. Nagi
(74) Momsen, Leonardos & Cia
(85) 05/09/2008
(86) PCT US2007/063304 de 05/03/2007
(87) WO WO2007/103867 de 13/09/2007
(21) PI 0708593-1 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 JP 2006-061716
(51) G03G 9/113 (2006.01), G03G 9/107 (2006.01)
(54) VEÍCULO, REVELADOR, MÉTODO DE FORMAÇÃO DE IMAGEM E
CARTUCHO DE PROCESSO
(57) VEÍCULO, REVELADOR, MÉTODO DE FORMAÇAO DE IMAGEM E
CARTUCHO DE PROCESSO. A presente invenção fornece um veículo e um
revelador, os quais têm menos ocorrências de adesão de veículo e manchas de
fundo, excelente granularidade e durabilidade mais longa. O veículo
compreende as partículas de material de núcleo com magnetismo e uma
camada de revestimento de resina cobrindo as partículas de material de núcleo,
e em que os diâmetros ponderais médios de partícula estão na faixa de 22 pm a
32 pm, a proporção dos diâmetros ponderais médios de partícula em relação ao
diâmetro numérico médio de partícula está na faixa de 1,00 a 1,20, o conteúdo
das partículas com um diâmetro de 20 µm ou menor é de 7% em massa, o
conteúdo das partículas de veículo com um diâmetro de 36 µm ou menor está
na faixa de 90% em massa a 100% em massa, e a proporção da densidade de
partícula das partículas do material de núcleo está na faixa de 85% a 100% da
densidade real das partículas do material de núcleo.
(71) Ricoh Company, Limited (JP)
(72) Masashi Nagayama, Kimitoshi Yamagushi, Naoki Imahashi
(74) Di Blasi, Parente, Vaz e Dias & Al.
(85) 05/09/2008
(86) PCT JP2007/054752 de 06/03/2007
(87) WO WO2007/102614 de 13/09/2007
(21) PI 0708594-0 A2 (22) 05/03/2007
1.3
(30) 06/03/2006 JP 2006-058825
(51) G03G 9/087 (2006.01), G03G 9/08 (2006.01)
(54) TONER, RECIPIENTE COM O TONER, REVELADOR, APARELHO DE
FORMAÇÃO DE IMAGEM E CARTUCHO DE PROCESSO E MÉTODO DE
FORMAÇÃO DE IMAGEM
(57) TONER, RECIPIENTE COM O TONER, REVELADOR, APARELHO DE
FORMAÇAO DE IMAGEM E CARTUCHO DE PROCESSO E METODO DE
FORMAÇAO DE IMAGEM. Um toner e um revelador os quais são excelentes
quanto à propriedade de limpeza e propriedade de fixação em baixa
temperatura e capazes de formar imagens com alta qualidade são fornecidos.
Um toner preparado pela dispersão e/ou emulsificação de uma fase oleosa ou
uma fase monomérica compreendendo uma composição de toner e/ou um
precursor de composição de toner em um meio à base de água para granular,
em que o toner tem uma circularidade média de 0,925 a 0,970 e a composição
de toner e/ou o precursor de composição de toner tem um material inorgânico
em camadas no qual pelo menos uma parte dos íons entre as camadas no
material inorgânico em camadas foi trocada por íons orgânicos.
(71) Ricoh Company, Ltd. (JP)
(72) Naohiro Watanabe, Shigeru Emoto, Yohichiroh Watanabe, Masahide
Yamada, Tsunemi Sugiyama, Masahiro Ohki, Akinori Saitoh, Ryota Inoue,
Osamu Uchinokura, Junichi Awamura
(74) Di Blasi, Parente, Vaz e Dias & Al
(85) 05/09/2008
64
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(86) PCT JP2007/054748 de 05/03/2007
(87) WO WO2007/105664 de 20/09/2007
(21) PI 0708595-8 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 US 60/780.093
(51) F16K 31/12 (2006.01), E21B 7/128 (2006.01)
(54) APARELHO DE PROTEÇÃO CONTRA FALHA PARA UM CONJUNTO
DE CONTROLE DE PRESSÃO
(57) APARELHO DE PROTEÇÃO CONTRA FALHA PARA UM CONJUNTO DE
CONTROLE DE PRESSÃO. A presente invenção provê um aparelho de
proteção contra falha incluindo uma fonte de ar proporcionando ar tendo uma
pressão pneumática, uma primeira válvula em comunicação hidráulica com a
fonte de ar permitindo a comunicação hidráulica de um fluido de controle entre
um primeiro orifício de fluido e um segundo orifício de fluido quando a pressão
pneumática for ao menos uma pressão pneumática mínima e proporcionando
comunicação hidráulica do fluido de controle entre o primeiro orifício de fluido e
o segundo orifício de fluido quando a pressão pneumática estiver abaixo da
pressão pneumática mínima, uma segunda válvula em comunicação hidráulica
com a fonte de ar impedindo a comunicação do ar entre uma entrada de ar e
uma saída de ar quando a pressão pneumática for ao menos a pressão
pneumática mínima e permitindo comunicação de ar entre a entrada de ar e a
saída de ar quando a pressão pneumática estiver abaixo da pressão
pneumática mínima, uma terceira válvula em comunicação hidráulica com a
fonte de ar permitindo comunicação de ar para uma terceira saída de válvula
quando a pressão pneumática for ao menos a pressão pneumática mínima e
impedindo a comunicação de ar para a terceira saida de válvula quando a
pressão pneumática estiver abaixo da pressão pneumática mínima, um
recipiente de pressao em comunicação hidráulica com a terceira saída de
válvula e tendo uma saída de ar, em que a saida de ar está em comunicação
hidráulica com a entrada de ar da segunda válvula, e um dispositivo de alerta
em comunicação hidráulica com a saida de ar da segunda válvula e operável
para emitir um som quando ar for comunicado a partir da saída de ar.
(71) M-I L.L.C (US)
(72) Alan Wayne Burkhard, Michael Scott Sawyer, Roger Lane Suter
(74) Orlando de Souza
(85) 05/09/2008
(86) PCT US2007/063598 de 08/03/2007
(87) WO WO2007/104025 de 13/09/2007
(21) PI 0708596-6 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 GB 0604602.3
(51) C07F 17/02 (2006.01), A61K 33/24 (2006.01), A61P 35/00 (2006.01)
(54) COMPOSTO DE RUTÊNIO, COMPOSIÇÃO, USO DE UM COMPOSTO, E,
MÉTODO DE TRATAMENTO DE UM INDIVÍDUO QUE SOFRE DE CÂNCER
(57) COMPOSTO DE RUTÊNIO, COMPOSIÇÃO, USO DE UM COMPOSTO, E,
METODO DE TRATAMENTO DE UM INDIVIDUO QUE SOFRE DE CÂNCER.
Um composto de rutênio (II) de fórmula (I) em quie X é halo ou um ligando
doador de O, N ou S neutro ou negativamente carregado; Y é um contra-íon; m
é 0 ou 1; q é 1, 2 ou 3; A é (Ru)-NRN1RN2- RN3- (N), onde RN1 e RN2 são
independentemente selecionados de H, C1-7 alquila, C3-20 heterociclila e C5-20
arila opcionalmente substituídas, e RN3 é C1-2 alquileno, ou (ii) um anel
aromático C5-6 contendo nitrogênio, em que o átomo de anel de nitrogênio é
ligado ao átomo de rutênio, e o anel é também ligado ao azo-nitrogênio, ou por
uma ligação simples em que a ligação é  ou ß para o anel de nitrôgenio, ou
por um grupo de -CH2 em que a ligação é  para o átomo de anel de nitrogênio;
B é C1-7 alquila, C3-20 heterociclila ou C5-20 arila opcionalmente substituída.
(71) The University Court Of The University Of Edinburgh (GB)
(72) Sarah Dougan, Abraha Habtermariam, Michael Melchart, Peter Sandler
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT GB2007/000784 de 07/03/2007
(87) WO ,WO2007/101997 de 13/09/2007
(21) PI 0708597-4 A2 (22) 01/03/2007
1.3
(30) 06/03/2006 US 11/276548
(51) F04B 49/06 (2006.01), F04B 13/02 (2006.01)
(54) SISTEMA DE BOMBEAMENTO QUE BOMBEIA PARA FORA UM
FLUIDO, DE UMA SÉRIE DE FLUIDOS COM VISCOSIDADES VARIADAS, E,
MÉTODO PARA OPERAR UMA BOMBA DE DESLOCAMENTO POSITIVO
COM UM, DE UMA SÉRIE DE FLUIDOS COM VISCOSIDADES VARIADAS
(57) SISTEMA DE BOMBEAMENTO QUE BOMBEJA PARA FORA UM
FLUIDO, DE UMA SÉRIE DE FLUIDOS COM VISCOSIDADES VARIADAS, E,
MÉTODO PARA OPERAR UMA BOMBA DE DESLOCAMENTO POSITIVO
COM UM, DE UMA SÉRIE DE FLUIDOS COM VISCOSIDADES VARIADAS.
Um sistema de bombeamento para bombear para fora um de uma série de
fluidos com viscosidades variadas. O sistema de bombeamento pode incluir
uma bomba de deslocamento positivo e um controle para operar a bomba de
deslocamento positivo. O controle pode incluir dados de compensação de
viscosidade. Os dados de compensação de viscosidade se relacionam a pelo
menos um dos fluidos, de modo que o controle instrua a bomba de
deslocamento positivo a operar com base na viscosidade do fluido.
(71) The Coca-Cola Company e Deka Products Limited Partnership (US)
(72) Robert Hughes, Gregg Carpentier, Lawrence B. Ziesel, David Newman,
Russell H. Beavis
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/063033 de 01/03/2007
(87) WO WO2007/136905 de 29/11/2007
(21) PI 0708598-2 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 FR 0602066
(51) F16D 41/20 (2006.01)
(54) DISPOSITIVO MECÂNICO ANTI-RECUO DE MOLA
(57) DISPOSITIVO MECÂNICO ANTI-RECUO DE MOLA. A invenção se refere
a um dispositivo mecânico anti-recuo de mola, capaz de assegurar a
solidarização ou a dessolidarização de um volante de comando manual (4) e de
um motor que age em um mesmo eixo de rotação, que compreende uma mola
cilíndrica (7, 16), um cilindro (9, 17), montado rotativo no eixo de rotação, a dita
mola podendo girar com o dito cilindro, as espiras da mola estando em contato
com a superficie do cilindro e suas extremidades sendo suscetíveis de entrar
em contato com o dito volante. As extremidades da mola (7, 16) são recurvadas
para o interior ou para o exterior, o dito volante (4) pode agir sobre a curva de
uma ou outra das extremidades da mola (7, 16), e a rotação da mola (7, 16) é
limitada por um batente que age contra uma ou outra das extremidades da
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 65
mola. Aplicação às válvulas de comando manual e comando motorizado, em
canalizações de fluidos.
(71) L. Bernard (FR)
(72) Thomas Braulich, Hervé Leroy, Etienne Bernardi
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT FR2007/000416 de 08/03/2007
(87) WO WO2007/101947 de 13/09/2007
(21) PI 0708599-0 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 JP 2006062427
(51) B29C 53/04 (2006.01), B29C 43/18 (2006.01), B29C 70/06 (2006.01),
B29K 105/08 (2006.01)
(54) PROCESSO E APARELHO PARA PRODUZIR MOLDAGEM DE FIBRAS
DE REFORÇO
(57) PROCESSO E APARELHO PARA PRODUZIR MOLDAGEM DE FIBRAS
DE REFORÇO. A presente invenção refere-se a um método para formar, em
um laminado em forma de tira de múltiplas lâminas de fibras de reforço
sobrepostas umas às outras, dois dobramentos com relação à configuração de
seção transversal dos mesmos, em que na formação dos dois dobramentos
com o uso de duas matrizes de formação de dobramento independentes uma
da outra, respectivamente, as duas matrizes de formação de dobramento são
arranjadas de maneira que a distância relativa das duas matrizes de formação
de dobramento é mudável na direção perpendicular à direção longitudinal do
laminado em forma de tira. Este método pode ser utilizado efetivamente na
produção de uma moldagem de fibras de reforço com mudança da distância
entre os dois dobramentos, isto é, largura de parte de tecido ou medida entre
duas partes de flange do laminado em forma de tira, ou na produção de
moldagem de resina reforçada com fibras (FRP) do mesmo.
(71) Toray Industries, Inc. (JP)
(72) Tamotsu Suzuki, Masatoshi Tsukamoto, Nobuo Asahara
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT JP2007/054514 de 08/03/2007
(87) WO 2007/102573 de 13/09/2007
(21) PI 0708600-8 A2 (22) 01/03/2007
1.3
(30) 06/03/2006 US 11/276550
(51) B67D 1/00 (2006.01)
(54) SISTEMA DISPENSADOR DE PRODUTO, E, SISTEMA DISPENSADOR
DE BEBIDA
(57) SISTEMA DISPENSADOR DE PRODUTO, E, SISTEMA DISPENSADOR
DE BEBIDA. O presente pedido descreve um dispensador de produto. O
dispensador de produto pode incluir pelo menos uma fonte de macro
ingrediente, pelo menos uma fonte de micro ingrediente posicionada sobre o
dispensador, uma fonte de diluente, uma válvula dispensadora, várias bombas
ou dispositivos de dosagem, e uma interface de usuário. A interface de usuário
recebe um pedido para um tipo de produto e instrui as bombas ou dispositivos
de dosagem para dispensar um tipo e uma relação predeterminados de macros
ingredientes, de micros ingredientes, e de diluente à válvula dispensadora a
uma vazão predeterminada.
(71) The Coca-Cola Company. (US)
(72) Nilang Patel, Gregg Carpenter, David Newman, Paul A. Phillips, Arthur G.
Rudick, Lawrence B. Ziesel
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/063031 de 01/03/2007
(87) WO 2007/136904 de 29/11/2007
(21) PI 0708601-6 A2 (22) 07/03/2007
1.3
(30) 10/03/2006 US 2006-0066431
(51) C07D 401/12 (2006.01), A61K 31/4439 (2006.01), A61K 45/00 (2006.01),
A61K 47/36 (2006.01), A61P 1/04 (2006.01), A61P 1/18 (2006.01), A61P 31/04
(2006.01), A61P 35/00 (2006.01), A61P 43/00 (2006.01)
(54) DERIVADO DE PIRIDINA, MÉTODO PARA PRODUZIR UM DERIVADO
DE
PIRIDINA,
COMPOSIÇÃO
FARMACÊUTICA,
AGENTE
ANTIHELICOBACTER PYLORI, E, AGENTE PROFILÁTICO OU TERAPÊUTICO
PARA UMA DOENÇA ASSOCIADA COM HELICOBACTER PYLORI
(57) DERIVADO DE PIRIDINA, MÉTODO PARA PRODUZIR UM DERIVADO
DE
PIRIDINA,
COMPOSIÇÃO
FARMACÊUTICA,
AGENTE
ANTIHELJCOBACÇrER PYL0RI, E, AGENTE PROFILÁTICO OU TERAPÊUTICO
PARA UMA DOENÇA ASSOCIADA COM HELICOBACTER PYLORI. O objetivo
é fornecer um produto farmacêutico excelente tendo uma atividade antiHelicobacter pylori. É divulgado um novo derivado de piridina representado pela
fórmula geral (I) ou um sal deste farmaceuticamente aceitável, que tem uma
atividade anti-bacteriana potente contra H. piroli (Helicobacter pylori) (I) em que
R representa um grupo hidroxialquila linear ou ramificado tendo de 5 a 10
átomos de carbono. Os exemplos da doença que pode ser prevenida/tratada
pela administração de um agente farmacêutico que compreende o composto
incluem gastrite, úlcera gástrica, úlcera duodenal, linfoma MALT gástrico, pólipo
hiperplástico gástrico, desenvolvimento de câncer gástrico depois da resecção
endoscópica do estágio inicial de câncer gástrico e outros.
(71) ARIGEN, INC. (JP)
(72) Masaharu Ito, Masaichi Yamamoto
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT JP2007/054387 de 07/03/2007
(87) WO 2007/105551 de 20/09/2007
(21) PI 0708602-4 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 SE 0600502-9
(51) A47C 27/06 (2006.01)
(54) COLCHÃO DE MOLA DE BOLSO
(57) COLCHÃO DE MOLA DE BOLSO. Um colchão de mola para camas,
compreendendo uma pluralidade de faixas (2) que são interligadas lado a lado e
compreendem um material de invólucro contínuo (3) com uma pluralidade de
bolsos separados (4) com molas espirais (5) encerradas nos mesmos. Além
disso, o material de invólucro para pelo menos alguns bolsos é pelo menos
substancialmente hermético ao ar, provendo, assim, uma resistência ao ar que
é pressionado para fora quando as molas do colchão são carregadas, o qual,
quando submetido a uma carga uniforme durante um período de transição (B),
resulta em uma compressão gradualmente crescente da mola ao seu estado
comprimido. Isto resulta em um colchão confortável no qual um usuário se
afunda gradualmente e que, por conseguinte, é confortável e seguro e permite
que o usuário facilmente se movimente. Um método e dispositivo
correspondentes para a fabricação de tal colchão são igualmente descritos.
(71) Stjernf Jadrar AB (SE)
(72) Nils Eric Stjerna
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT SE2007/000219 de 08/03/2007
(87) WO 2007/102772 de 13/09/2007
66
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
medida que os nós de ponte aprendem novas estações na LAN, eles anunciam
rotas aos outros nós na rede em malha especificando como alcançar aquelas
estações. Isto habilita a funcionalidade de Ponte MAC entre redes em malha
sem fios e 802 LANs.
(71) Microsoft Corporation (US)
(72) Adam Sapek, Thiruvengadam Venketesan
(74) Alexandre Ferreira
(85) 05/09/2008
(86) PCT US2007/003512 de 08/02/2007
(87) WO 2007/106266 de 20/09/2007
(21) PI 0708603-2 A2 (22) 08/03/2007
1.3
(30) 10/03/2006 US 11/372875; 14/07/2006 US 60/807400
(51) C22B 15/00 (2006.01)
(54) MÉTODOS PARA PRODUZIR E REFINAR UM METAL EM UM MÉTODO
ELETROLÍTICO, PARA REFINO ELETROLÍTICO DE METAIS, E PARA
PRODUZIR ELETROLITICAMENTE UMA LIGA
(57) MÉTODOS PARA PRODUZIR E REFINAR UM METAL EM UM MÉTODO
ELETROLÍTICO, PARA REFINO ELETROLÍTICO DE METAIS, E PARA
PRODUZIR ELETROLITICAMENTE UMA LIGA. A presente invenção diz
respeito a um método para produção e refino eletrolítico de metais com um
ponto de fusão acima de cerca de 1.00 ºC, particularmente silício, onde é
provida uma primeira célula eletrolítica com uma camada superior de eletrólito
fundido de um primeiro eletrólito, uma camada inferior de liga fundida de uma
liga do metal a ser refinado, e pelo menos um metal mais nobre que o metal a
ser refinado. A camada de liga inferior é o catodo na primeira célula e um anodo
é posicionado na camada superior de eletrólito fundido. Uma segunda célula
eletrolítica é também provida com uma camada superior de metal fundido do
mesmo metal que o metal a ser refinado, a dita camada constituindo um catodo,
uma camada inferior de liga fundida, a dita camada inferior constituindo um
anodo, a dita liga tendo uma maior densidade que ometal aserrefinado, e uma
camada intermediária de eletrólito fundido com uma densidade entre a
densidade das camadas fundidas superior e inferior. Ambos os eletrólitos são
eletrólitos a base de óxido contendo óxido do metal a ser refinado, e o eletrólito
está em um estado fundido e tem um ponto de fusão abaixo da temperatura
operacional do processo. Matéria-prima compreendendo um óxido do metal a
ser refinado é adicionada à primeira célula e corrente elétrica continua é
conduzida através do anodo para o catodo de maneira tal que o metal a ser
refinado mova-se do anodo e seja depositado no estado fundido no catodo. As
duas células podem ser operadas em duas etapas separadas. Uma para
produzir uma liga e a outra para refinar metal da liga.
(71) Elkem AS (NO)
(72) Sadoway Donald, Kay Johansen, Bjorn Myhre, Marianne Engvoll, Krister
Engvoll
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/063555 de 08/03/2007
(87) WO 2007/106709 de 20/09/2007
(21) PI 0708605-9 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/780.589; 09/03/2006 US 11/715.760
(51) A62B 18/02 (2006.01)
(54) VEDAÇÃO DE GEL SUPER MACIA E MÁSCARA UTILIZANDO A MESMA
(57) VEDAÇÃO DE GEL SUPER MACIA E MÁSCARA UTILIZANDO A MESMA.
Trata-se de uma vedação (18) que entra em contato com uma parte de um
paciente para proporcionar uma interface confortável entre um dispositivo
externo, tal como uma máscara respiratória, e o paciente. A vedação inclui um
invólucro elástico (27) cheio com uma substância de gel macio (36) possuindo
uma penetração de cone de a partir de 5 até 200 penetrações.
(71) RIC INVESTMENTS, LLC (US)
(72) Peter Chi Fai Ho
(74) Alexandre Ferreira
(85) 05/09/2008
(86) PCT US2007/063678 de 09/03/2007
(87) WO 2007/104042 de 13/09/2007
(21) PI 0708604-0 A2 (22) 08/02/2007
1.3
(30) 13/03/2006 US 11/375.292
(51) H04L 12/28 (2006.01), H04L 12/46 (2006.01), H04L 12/66 (2006.01)
(54) CONEXÃO DE REDES EM MALHA MULTI-SALTOS USANDO PONTE
MAC
(57) CONEXÃO DE REDES EM MALHA MULTI-SALTOS USANDO PONTE
MAC. É divulgada uma rede em malha multi-saltos que pode ser conectada em
uma Rede de Área Local (LAN) usando uma Ponte MAC. Um ou mais nós na
rede em malha podem ser configurados como um nó de ponte que emprega
uma ponte MAC. Pacotes que se deslocam entre estações na LAN até nós na
rede em malha fluem através de um dos nós de ponte na rede em malha. Os
nós de ponte não recebem todos os pacotes na rede em malha, mas eles
recebem os pacotes que devem ser transmitidos através da ponte MAC. A
(21) PI 0708607-5 A2 (22) 27/02/2007
1.3
(30) 08/03/2006 EP 06 110812.2
(51) C07D 233/92 (2006.01), A61K 31/4025 (2006.01)
(54) 1,5-DIIDRO-IMIDAZOL-2-ONAS 4-AMINO-1,5-SUBSTITUÍDAS
(57) 1 ,5-DIIDRO-IMIDAZOL-2-ONAS 4-AMINO-1 ,5-SUBSTITUIDAS. A
presente invenção refere-se a compostos da fórmula geral em que R1 é -(CH2)
n-arila ou -(CH2) n-heteroarila, em que tais grupos são não-substituídos ou
substituídos por um ou mais substituintes, selecionados do grupo consistindo
em halogênio, alquila inferior substituída por halogênio, alcóxi inferior, alquila
inferior, ciano, nitro, -O-alquila inferior substituída por halogênio ou morfonila; R2
é -CH2) n-arila ou -(CH2) n-heteroarila, em que tais grupos são não-substituídos
ou substituídos por um ou mais substituintes, selecionados do grupo consistindo
em Alquila inferior, Alcóxi inferior, halogênio ou - N(Alquila inferior) 2; R3 é
hidrogênio ou Alquila inferior; R4 é -CH2) n -arila ou -(CH2) n-heteroarila, em que
RPI 2109 de 07/06/2011
tais grupos são não-substituídos ou substituídos por um ou mais substituintes,
selecionados do grupo consistindo em halogênio ou alcóxi inferior, ou é alquila
inferior, - (CH2) n-cicloalquila; ou R3 e R 4 formam juntos com o átomo de N um
anel heterocíclico; n é 0, 1 ou 2; e para sais de adição de ácido
farmaceuticamente aceitáveis dos mesmos. Descobriu-se que os compostos de
fórmula geral I ou suas fórmas tautoméricas são bons inibidores do
transportador de glicina 1 (GlyT-1), e que eles têm uma boa seletividade para
inibidores de transportador de glicina 2 (GlyT-2), úteis para o tratamento de
esquizofrenia.
(71) F.Hoffmann-La Roche AG (CH)
(72) Synese Jolidon, Robert Narquizian, Roger Norcross, Emmanuel Pinard
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT EP2007/051824 de 27/02/2007
(87) WO 2007/101802 de 13/09/2007
(21) PI 0708608-3 A2 (22) 01/03/2007
1.3
(30) 03/03/2006 US 11/367,136
(51) F02B 25/00 (2006.01), F02D 13/02 (2006.01)
(54) ORIFÍCIOS DE TOMADA DE AR PARA MOTOR DE DOIS TEMPOS
(57) ORIFÍCIOS DE TOMADA DE AR PARA MOTOR DE DOIS TEMPOS. A
presente invenção refere-se a um motor de dois tempos de uma configuração
particular que pode ter a sua saída de potência aumentada pelo acionamento
de pistões maiores e pelo uso de orifícios na saia do pistão através do qual
conduz ar comprimido dentro da saia através de passagens curtas no
alojamento do cilindro que conduzem o ar a partir do inte rior da saia para
acima do pistão. Como resultado, um pistão maior pode ser usado para o
mesmo espaçamento e tamanho de orifício no bloco de modo a economizar a
necessidade de reprojeto do bloco e do eixo de manivelas. Um ajustador de
posição para o pistão move o pistão axialmente sem rotação dos orifícios do
pistão para fora do alinhamento com os orifícios de entrada no alojamento. A
haste do pistão é mantida na cruzeta pelo uso de uma chapa para evitar a
rotação, enquanto uma porca de ajustador, que é girada, cria movimento axial
na haste do pistão com uma contraporca que prende a posição final do pistão.
(71) Cameron International Corporation (US)
(72) Bruce A. Chrisman, Randy Coleman
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 03/09/2008
(86) PCT US2007/005331 de 01/03/2007
(87) WO 2007/103165 de 13/09/2007
(21) PI 0708610-5 A2 (22) 01/03/2007
1.3
(30) 06/03/2006 US 11/276,551
(51) B67D 1/00 (2006.01)
(54) SISTEMA DE CONJUNTO DE BOCAL E MÉTODO DE DISPENSAR UMA
BEBIDA
(57) SISTEMA DE CONJUNTO DE BOCAL E METODO DE DISPENSAR UMA
BEBIDA. A presente invenção descreve um conjunto de bocal. O conjunto de
bocal pode incluir um direcionador de fluxo com um primeiro caminho de fluxo e
um segundo caminho de fluxo, um conjunto de fluxo terciário com uma
quantidade de terceiros caminhos de fluxo, e um alvo alongada posicionada
sobre o direcionador de fluxo, de modo que o primeiro caminho de fluxo, o
segundo caminho de fluxo e a quantidade de terceiros caminhos de fluxo se
juntem ao longo do alvo alongado.
(71) The Coca-Cola Company. (US)
(72) David Harvey, Lawrence B. Ziesel
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 67
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/063035 de 01/03/2007
(87) WO 2007/117784 de 18/10/2007
(21) PI 0708611-3 A2 (22) 05/03/2007
1.3
(30) 07/03/2006 US 60/779,940
(51) C07D 498/18 (2006.01), C07D 498/22 (2006.01), A61K 31/436 (2006.01),
A61P 25/00 (2006.01)
(54) COMPOSTO; USO DO COMPOSTO NA PREPARAÇÃO DE UM
MEDICAMENTO
PARA
TRATAMENTO
DE
UM
TRANSTORNO
NEUROLÓGICO EM UM MAMÍMEFO; MÉTODO DE PREPARAÇÃO DO
COMPOSTO; E MÉTODO DE TRATAMENTO DE UM TRANSTORNO
NEUROLÓGICO EM UM MAMÍFERO
(57) COMPOSTO; USO DO COMPOSTO NA PREPARAÇÃO DE UM
MEDICAMENTO
PARA
TRATAMENTO
DE
UM
TRANSTORNO
NEUROLÓGICO EM UM MAMÍFERO; METODO DE PREPARAÇÃO DO
COMPOSTO; E MÉTODO DE TRATAMENTO DE UM TRANSTORNO
NEUROLÓGICO EM UM MAMÍFERO. Descreve um composto com a estrutura:
Descrevem-se esse composto e seu uso na preparação de medicamentos
utilizáveis no tratamento de transtornos neurodegenerativos.
(71) Wyeth (US)
(72) Edmund Idris Graziani, Kevin Pong
(74) Trench, Rossi e Watanabe Advogados
(85) 05/09/2008
(86) PCT US2007/005645 de 05/03/2007
(87) WO 2007/103347 de 13/09/2007
(21) PI 0708612-1 A2 (22) 28/02/2007
1.3
(30) 06/03/2006 US 11/276,553
(51) A23L 2/52 (2006.01), B67D 1/00 (2006.01)
(54) MÉTODOS PARA ELABORAR UMA COMPOSIÇÃO E PARA FORNECER
UMA BEBIDA E APARELHO PARA PREPARAR SELETIVAMENTE UMA
BEBIDA
(57) MÉTODOS PARA ELABORAR UMA COMPOSIÇÃO E PARA FORNECER
UMA BEBIDA E APARELHO PARA PREPARAR SELETIVAMENTE UMA
BEBIDA. Um método e aparelho para elaborar uma composição compreende
armazenar pelo menos um ácido em um recipiente de armazenamento de
ácido, armazenar pelo menos um componente ácido degradável em um
recipiente de armazenamento de componente, e misturar o pelo menos um
ácido do recipiente de armazenamento de ácido e o pelo menos um
componente ácido degradável do recipiente de armazenamento de
componente, de modo que o pelo menos um ácido e o pelo menos um
68
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
componente ácido degradável se misturem e formem a composição. Um
método e aparelho para prover uma bebida selecionada de uma pluralidade de
bebidas selecionáveis compreendendo armazenar um número de concentrados
de componente de bebida não-adoçantes separadamente em um respectivo
número de recipientes de armazenamento de componente de bebida
concentrados de componente de bebida e em resposta à seleção da bebida
selecionada, dispensando automaticamente, de modo contínuo em uma
proporção predeterminada para qualquer volume da bebida dispensada,
qualquer combinação de pelo menos dois ou mais do número de concentrados
de componente de bebida não-adoçantes e um diluente.
(71) The Coca-Cola Company (US)
(72) Lawrence B. Ziesel, Newton R. White, Kelly H. Sepcic, Gregg Carpenter,
Robert D. Hughes, IV
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/062973 de 28/02/2007
(87) WO 2007/146452 de 21/12/2007
(21) PI 0708613-0 A2 (22) 23/02/2007
1.3
(30) 08/03/2006 DE 10 2006 010 643.1
(51) A61K 9/00 (2006.01), A61K 47/18 (2006.01)
(54) MEDICAMENTO CONTENTDO FLUOROQUINOLONA
(57) MEDICAMENTO CONTENDO FLUOROQUINOLONA. A presente
invenção refere-se ao uso de compostos de amônio quaternário para impedir
precipitações de fluoroquinolonas de suas soluçóes, bem como medicamentos
toleráveis, estáveis, especialmente adequados para a aplicação parenteral, que
em forma dissolvida contêm uma fluoroquinolona e um composto de amônio
quaternário.
(71) Bayer Animal Health Gmbh (DE)
(72) Iris Heep, Kristine Fraatz, Hans-Jürgen Hamann, Markus Edingloh
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT EP2007/001569 de 23/02/2007
(87) WO 2008/025380 de 06/03/2008
(21) PI 0708614-8 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/780,515
(51) C12N 9/10 (2006.01)
(54) ALDOLASES, ÁCIDOS NUCLÉICOS CODIFICANDO AS MESMAS E
MÉTODOS PARA PRODUZIR E USAR AS MESMAS
(57) ALDOLASES, ÁCIDOS NUCLÉICOS CODIFICANDO AS MESMAS E
MÉTODOS PARA PRODUZIR E USAR AS MESMAS. Esta presente invenção
refere-se a polipeptídios com atividade de aldolase, incluindo atividade de
piruvato tal como, sem limitação, atividade de HMG e/ou KHG aldolase,
polinucleotídeos codificando esses poíipeptídios, e métodos para produzir e
usar esses polinucleotídeos e polipeptídios. Em algumas modalidades, a
presente invenção refere-se a polipeptídios com atividade de aldolase, incluindo
atividade de piruvato tal como, sem limitação, atividade de HMG e/ou KHG
aldolase, incluindo atividade termoestável e termotolerante, e polinucleotídeos
codificando essas enzimas, e à produção e uso desses polinucíeotídeos e
polipeptídios. Os polipept(dios de acordo com a invenção podem ser usados em
uma variedade de contextos farmacêuticos, agrícolas e industriais. Em algumas
modalidades, a invenção fornece polipeptídios e vias biossintéticas que são
úteis na produção de ácido R-2-hidróxi 2-(indol-3-ilmetil)-4-cetO glutárico (RMP) e certos este reoisômeros de monatina, tais como R,R e S,R monatina, e
sais dos mesmos, assim como certos estereoisômeros de derivados de
monatina, tais como as configurações R,R e S,R, e sais dos mesmos.
(71) Verenium Corporation (US)
(72) Ellen Burke, Paula M. Hicks, Peter Luginbuhl, Toby Richardson, David P.
Weiner, Lishan Zhao
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
RPI 2109 de 07/06/2011
(85) 05/09/2008
(86) PCT US2007/063515 de 07/03/2007
(87) WO 2007/103989 de 13/09/2007
(21) PI 0708615-6 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 US 60/779,805; 14/12/2006 US 60/874,832
(51) C07D 471/04 (2006.01), A61K 31/437 (2006.01), A61P 35/00 (2006.01)
(54) COMPOSTOS DE PIRAZOL HETEROBICÍCLICOS E MÉTODOS DE USO
(57) COMPOSTOS DE PIRAZOL HETEROBICICLICOS E MÉTODOS DE USO.
Compostos de Fórmulas (la) e (lb), e estereoisômeros, isômeros geométricos,
tautômeros, solvatos, metabólitos e sais farmaceuticamente aceitáveis destes,
são úteis para inibir tirosina cinases receptoras e para tratar distúrbios
mediados desse modo. Métodos de utilizar compostos de Fórmula la e lb, e
estereoisômeros, isômeros geométricos, tautômeros, solvatos e sais
farmaceuticamente aceitáveis destes, para diagnóstico ín vitro, in situ e ín vivo,
prevenção ou tratamento de tais distúrbios em células mamífero ou condições
patológicas associadas, são descritos.
(71) Array Biopharma Inc. (US) , Genentech, INC. (US)
(72) James F. Blake, Steven Armen Boyd, Frederick Cohen, Jason de Meese,
Kin Chiu Fong, John J. Gaudino, Thomas Kaplan, Allison L. Marlow, Jeongbeob
Seo, Allen A. Thomas, Hongqi Tian, Wendy B. Young
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT US2007/005583 de 06/03/2007
(87) WO 2007/103308 de 13/09/2007
(21) PI 0708616-4 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 JP 2006-064150
(51) H02M 7/155 (2006.01), H02M 7/12 (2006.01), H02M 7/162 (2006.01)
(54) CONVERSOR DE POTÊNCIA E MÉTODO E CIRCUITO DE GERAÇAO
DE ONDA TRIANGULAR
(57) CONVERSOR DE POTÊNCIA E METODO E CIRCUITO DE GERAÇÃO
DE ONDA TRIANGULAR. A presente invenção refere-se a um conversor de
potência que converte uma potência CA extraída a partir de um gerador em
uma potência CC e a supre para uma bateria (carga). O conversor de potência
inclui um tiristor (unidade de comutador) conectado entre uma unidade de saída
do gerador e a bateria (carga); e uma unidade de controle de porta (unidade de
controle) para a geração de uma voltagem de onda triangular que tem uma
voltagem de pico constante correspondente a cada ciclo da potência CA
extraída a partir do gerador, a geração de uma voltagem diferencial entre a
voltagem suprida para a carga através da unidade de comutador e uma
voltagem-alvo predeterminada, e o controle do estado condutivo da unidade de
comutador, com base na voltagem de onda triangular e na voltagem diferencial.
(71) Shindengen Electric Manufacturing CO., LTD. (JP)
(72) Toyotaka takashima
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT JP2007/054679 de 09/03/2007
(87) WO 2007/102601 de 13/09/2007
(21) PI 0708617-2 A2 (22) 27/02/2007
1.3
(30) 07/03/2006 EP 06110772.8
(51) C08J 9/00 (2006.01), C08J 9/20 (2006.01)
(54) PROCESSO PARA PRODUÇÃO DE POLÍMEROS DE ESTIRENO
EXPANSÍVEIS
(57) PROCESSO PARA PRODUÇÃO DE POLÍMEROS DE ESTIRENO
EXPANSÍVEIS. Um processo para preparar polímeros de estireno expansíveis
com estreita distribuição de tamanho de conta, que podem ser processados em
espumas com estrutura celular homogênea e baixa condutividade térmica,
polimerizando-se os monômeros em suspensão aquosa, na presença de um
RPI 2109 de 07/06/2011
agente de sopro volátil e de 0,1 a 30 ppm, com base na fase orgânica, de uma
hidroxialquilamina.
(71) Basf SE (DE)
(72) Christian Exner, Jan Holoch
(74) Momsen, Leonardos & Cia
(85) 05/09/2008
(86) PCT EP2007/051850 de 27/02/2007
(87) WO 2007/101805 de 13/09/2007
(21) PI 0708618-0 A2 (22) 13/03/2007
1.3
(30) 14/03/2006 US 60/782150
(51) A01N 65/00 (2009.01)
(54) MÉTODO PARA O CONTROLE DO CRESCIMENTO TERMINAL DE UMA
PLANTA DE ALGODÃO , E, COMPOSIÇÃO ADEQUADA PARA O CONTROLE
DO CRESCIMENTO TERMINAL DE UMA PLANTA DE ALGODÃO
(57) MÉTODO PARA O CONTROLE DO CRESCIMENTO TERMINAL DE UMA
PLANTA DE ALGODÃO, E, COMPOSIÇÃO ADEQUADA PARA O CONTROLE
DO CRESCIMENTO TERMINAL DE UMA PLANTA DE ALGODÃO. O controle
do crescimento terminal de plantas de algodão, que resulta em uma
produtividade melhorada, é obtido através do tratamento com: 1) um composto
de inibição da enzima de protoporfirinogeno oxidase (inibição da PPO), 2) um
composto regulador de crescimento da cultura (HGR), 3) um composto de
ruptura de membrana de célula (CMD) ou 4). compostos de inibição de síntese
de aminoácido (inibição de AAS). O uso de carfentrazona-etil e de certos
metabólitos da mesma é de interesse especial para o controle do crescimento
de plantas de algodão.
(71) Fmc Corporation (US)
(72) Tom I. Crumby, Jr., Joseph P. Reed, Henry R. Mitchell, Stewart Throop,
John S. Wilson, John C. Braun
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/006301 de 13/03/2007
(87) WO 2007/106482 de 20/09/2007
(21) PI 0708619-9 A2 (22) 06/03/2007
1.3
(30) 08/03/2006 US 60/780252
(51) A61K 31/497 (2006.01), A61P 19/10 (2006.01)
(54) USO DE UM COMPOSTO, E, MÉTODOS PARA PREVINIR E/OU
TRATAR DISTÚRBIOS OU CONDIÇÕES RELACIONADOS COM O OSSO,
PARA PREVINIR E/OU TRATAR OSTEOPOROSE, PARA AUMENTAR A
FORMAÇÃO ÓSSEA, PARA AUMENTAR A DENSIDADE MINERAL ÓSSEA,
PARA REDUZIR A INCIDÊNCIA DE FRATURA, E PARA REALÇAR A
CICATRIZAÇÃO DA FRATURA
(57) USO DE UM COMPOSTO, E, METODOS PARA PREVENIR E/OU
TRATAR DISTURBIOS OU CONDIÇÕES RELACIONADOS COM O OSSO,
PARA PREVENIR E/OU TRATAR OSTEOPOROSE, PARA AUMENTAR A
FORMAÇÃO ÓSSEA, PARA AUMENTAR A DENSIDADE MINERAL ÓSSEA,
PARA REDUZIR A INCIDÊNCIA DE FRATURA, E PARA REALÇAR A
CICATRIZAÇÃO DE FRATURA. A presente invenção diz respeito a um novo
uso de um composto da fórmula (I) em que R1 é NH2, piperazin-1-ila, 4metilpiperazin-1-ila, 4-metil-1 ,4-diazepan-1-ila ou 4-etilpiperazin-1-ila; R2 é
hidrogênio, flúor, CH3, CH2CH3, oCH3 CF3 ou OCF3; R3 é hidrogênio, CH3 ou
flúor; como uma base livre ou um sal deste farmaceuticamente aceitável, na
fabricação de um medicamento para a prevenção e/ou tratamento de distúrbios
relacionados com o osso, osteoporose e aumentar a formação óssea,
densidade mineral óssea. A presente invenção diz respeito ainda a um método
de prevenção e/ou tratamento destes distúrbios.
(71) AstraZeneca AB (SE)
(72) Anna-Lena Berg, Ratan Bhat
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT SE2007/000216 de 06/03/2007
(87) WO 2007/102770 de 13/09/2007
(21) PI 0708620-2 A2 (22) 09/03/2007
1.3
(30) 14/03/2006 JP P2006-069343
(51) A61B 5/11 (2006.01), A61B 5/22 (2006.01), G01C 22/00 (2006.01), G06M
3/00 (2006.01)
(54) APARELHO DE DETECÇÃO DE MOVIMENTO DO CORPO, MÉTODO DE
DETECÇÃO DE MOVIMENTO DE CORPO, E, PROGRAMA DE DETECÇÃO
DE MOVIMENTO DE CORPO
(57) APARELHO DE DETECÇÃO DE MOVIMENTO DE CORPO, METODO DE
DETECÇÃO DE MOVIMENTO DE CORPO, E, PROGRAMA DE DETECÇÃO
DE MOVIMENTO DE CORPO. Meio de extração de componente vertical (2)
extrai um componente vertical de um vetor de aceleração correspondendo a
movimento de corpo de um usuário de um sensor de aceleração de três eixos
(1), e o componente vertical é separado por uma unidade separadora de banda
alta/banda baixa (3) em um componente de banda alta e um componente de
banda baixa. Usando estes componentes, uma unidade de processamento de
detecção/determinação de pico (4) detecta candidato de posição de pico de
ação do usuário na direção vertical, identifica um candidato de posição de pico
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 69
na base de uma relação de energia entre o componente de banda alta e o
componente de banda baixa, executa casamento de forma de onda relativo a
uma gama predeterminada incluindo cada candidato de posição de pico, por
esse meio determinando uma posição de pico, e detecta movimento de corpo
na base da posição de pico, e uma unidade analisadora de posição de passo
(5) detecta um lance de movimento de corpo. Por conseguinte, sem ser afetado
por vários tipos de ruído, se toma possível detectar precisamente movimento de
corpo do usuário na direção vertical, e também detectar precisamente o lance
de movimento de corpo do usuário como precisado.
(71) Sony Corporation (JP)
(72) Kenichi Makino, Akane Sano, Motoyuki Takai
(74) Monsen, Leonardos & CIA
(85) 05/09/2008
(86) PCT JP2007/054710 de 09/03/2007
(87) WO 2007/105648 de 20/09/2007
(21) PI 0708621-0 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 NO 20061102
(51) F16L 1/26 (2006.01)
(54) FERRAMENTAS DE REPARO E MANUTEÇÃO DE TUBULAÇÕES
SUBMARINAS E MÉTODOS PARA SUBSTITUIÇÃO DE TUBULAÇÕES
ROMPIDAS
(57) FERRANENTAS DE REPARO E MANUTENÇÃO DE TUBULAÇÕES
SUBMARINAS E METODO PARA SUBSTITUIÇAO DE TUBULAÇÕES
ROMPIDAS. A presente invenção se refere a um conector de reparo de
tubulação (40) para um sistema de reparo de tubulações submarinas, disposto
para conectar e desconectar tubulações no fundo do oceano. A invenção
também se refere a um sistema incluindo um conector (40) e a um método para
substituição de tubulações rompidas no fundo do oceano.
(71) AS Connector (NO)
(72) Ingolf Horne
(74) Magnus Aspeby e Claudio Szabas
(85) 08/09/2008
(86) PCT NO2007/000091 de 07/03/2007
(87) WO 2007/102744 de 13/09/2007
(21) PI 0708622-9 A2 (22) 07/03/2007
1.3
(30) 08/03/2006 US 11/371,117
(51) A61K 9/16 (2006.01), A61P 27/02 (2006.01)
(54) TERAPIA OCULAR USANDO AGENTES QUE ATIVAM A SIRTUINA
(57) TERAPIA OCULAR USANDO AGENTES QUE ATIVAM A SIRTUINA. As
composições oftalmicamente terapêuticas, tais como os sistemas de liberação
de fármacos poliméricos, incluem um componente terapêutico que inclui um
agente que ativa a sirtuina, tal como o resveratrol, o qual, com a liberação para
o segmento posterior de um olho de um mamífero, trata as condições oculares.
Os métodos de preparar e usar as presentes composições são também
descritos.
(71) Allergan, INC (US)
(72) John E. Donello, Rong Yang, Elizabeth Wolde Mussie, Fabien J.
Schweighoffer
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/063454 de 07/03/2007
(87) WO 2007/103960 de 13/09/2007
70
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0708623-7 A2 (22) 01/03/2007
1.3
(30) 08/03/2006 EP 06 110854.4
(51) C07C 51/41 (2006.01), C07C 51/47 (2006.01), C07C 51/02 (2006.01),
C07C 59/08 (2006.01), C07C 209/68 (2006.01)
(54) MÉTODO PARA PREPARAR UM COMPLEXO DE AMINA
ORGÂNICA/ÁCIDO LÁTICO
(57) MÉTODO PARA PREPARAR UM COMPLEXO DE AMINA
ORGÂNICA/ÁCIDO LÁTICO. A presente invenção refere-se a um método para
preparar um complexo de uma amina orgânica e de ácido lático em um reator,
caracterizado pelo fato de que uma amina orgânica miscível em água é
colocada em contato com lactato de magnésio, em um meio aquoso, no reator,
para formar o complexo e hidróxido de magnésio precipitado, após o que o
hidróxido de magnésio é separado do complexo.
(71) Purac Biochem B.V. (NL)
(72) Jan Van Krieken
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT IB2007/050668 de 01/03/2007
(87) WO 2007/102105 de 13/09/2007
(21) PI 0708624-5 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 GB 0604826.8
(51) A61K 31/4458 (2006.01), A61P 11/06 (2006.01), A61P 17/00 (2006.01),
A61P 1/00 (2006.01), A61P 19/00 (2006.01), A61P 19/02 (2006.01), A61P
29/00 (2006.01), A61P 1/02 (2006.01), A61P 13/12 (2006.01), A61P 37/00
(2006.01)
(54) USO DE BETA-AMINOÁLCOOIS PARA O TRATAMENTO DE
DISTÚRBIOS INFLAMATÓRIOS E DOR
(57) USO DE BETA-AMINOALCOOIS PARA O TRATAMENTO DE
DISTURBIOS INFLAMATÓRIOS E DOR. Compostos que podem ser utilizados
para o tratamento ou prevenção de uma condição associada com a proliferação
de células T ou que é mediada através de citocinas pró-inflamatórias e que são
de fórmula (I): onde pelo menos um de R1, R 2 e R3 não é H e cada um é
independentemetne H, alquila, CF3, CONH2, CN, halogênio, NH2, NO2, NHCHO,
NHCOHN2. NHSO2alquila, SOMe, SO2NH2, Salquila, ou CH2SO2alquila; e R4 é
H ou alquila, ou sal dos mesmos.
(71) Sosei R&D Ltd. (GB)
(72) Andrew Douglas Baxter
(74) Montaury Pimenta, Machado & lioce
(85) 08/09/2008
(86) PCT GB2007/000821 de 09/03/2007
(87) WO WO2007/102011 de 13/09/2007
(21) PI 0708625-3 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/780.539; 08/03/2007 US 11/683.781
(51) C09K 8/03 (2006.01), C09K 8/04 (2006.01)
(54) COMPOSIÇÕES DE DESVIO, TAMPÕES DE CONTROLE DE PERDA DE
FLUIDO E SECCIONADORES DESSES
(57) COMPOSIÇÕES DE DESVIO, TAMPÕES DE CONTROLE DE PERDA DE
FLUIDO E SECCIONADORES DESSES. É revelado um método de tratamento
de um poço que inclui a colocação seletiva de um tampão de perda de tluido no
poço, em que o tampão de perda de fluido inclui pelo menos um de dietileno
glicol, trietileno glicol, e tetraetileno glicol, e em que pelo menos um de dietileno
glicol, trietileno glicol, e tetraetileno glicol reage com a salmoura de cálcio
presente no poço para formar um plugue.
(71) M-I L.L.C. (US)
(72) Michael A. Freeman, Robert L. Horton, Bethicia B. Prasek
(74) Orlando De Souza
(85) 08/09/2008
(86) PCT US2007/063706 de 09/03/2007
(87) WO 2007/104054 de 13/09/2007
RPI 2109 de 07/06/2011
(21) PI 0708626-1 A2 (22) 17/04/2007
1.3
(30) 19/04/2006 US 60/745,099
(51) C07F 11/00 (2006.01), C07F 13/00 (2006.01)
(54) PROCESSO PARA PREPARAR DIAQUILDITIOCARBAMATOS DE
MOLIDÊNIO, SULFURIZADOS
(57) PROCESSO PARA PREPARAR DIALQUILDITIOCARBAMATOS DE
MOLIBDENIO, SULFURIZADOS. É provido um processo para a fabricação de
ditiocarbamatos de metal, altamente sulfurizados, tal corno ditiocarbamato de
molibdênio. Uma fonte de metal, água e uma amina reagente são aquecidas
sob pressão com dissulfeto de carbono.
(71) R.T. Vanderbilt Company, INC. (US)
(72) Keith Smith Mcclain, Kenneth Barry Jolly, Shaun Jeremy Ensor, Daniel
Gershon, Robert John Tynik, Clifford Dee Vail, Stephen Gerard Wojtowicz
(74) Montaury Pimneta, Machado & Lioce S/C Ltda
(85) 08/09/2008
(86) PCT US2007/066768 de 17/04/2007
(87) WO WO2007/136949 de 29/11/2007
(21) PI 0708627-0 A2 (22) 27/02/2007
1.3
(30) 13/03/2006 US 11/373,284
(51) G01N 33/487 (2006.01), G01N 35/00 (2006.01)
(54) SISTEMA DE TESTES DE DIAGNÓSTICO E RESPECTIVO MÉTODO DE
CODIFICAÇÃO
(57) Sistema de Testes de Diagnóstico e Respectivo Método de Codificação.
Resumo. Um sistema de testes de diagnóstico pode incluir um medidor para
realizar um teste de diagnóstico numa amostra aplicada a uma meio de teste,
tendo o medidor um alojamento e uma interface para receber um sinal que
representa informações de codificação e um recipiente configurado para conter
meio de teste compatível com o medidor, tendo o recipiente um elemento de
codificação associado a ele. Além disso, o sistema pode proporcionar um
mecanismo para remover o medidor a partir de um recipiente de teste
interconectado e religá-lo a um novo recipiente que usa métodos de codificação
internos ao recipiente que pode calibrar novamente o medidor para o novo
recipiente de tiras de teste. O sistema pode ainda proporcionar um dispositivo
de amostragem, tal como uma lanceta, operavelmente conectada ao recipiente
de tal maneira que um usuário pode usar o dispositivo de amostragem para
obter uma amostra sem desconectar o dispositivo de amostragem do recipiente.
Além disso, o sistema pode ainda proporcionar um recipiente capaz de ser
enchido de novo de tiras de teste que inclui uma bolsa de lâminas de tiras de
teste com uma pilula exsicante usada encher de novo o recipiente de tiras de
teste, quando vazio.
(71) Home Diagnostics, INC. (US)
(72) Gary T. Neel, Brent E. Modzekewski, George R. Rounds, Carlos OTI, Allan
Javier Caban
(74) Hugo Silva, Rosa & Maldonado - Propriedade Intelectual
(85) 08/09/2008
(86) PCT US2007/005079 de 27/02/2007
(87) WO WO2007/108900 de 27/09/2007
(21) PI 0708629-6 A2 (22) 03/05/2007
1.3
(30) 05/05/2006 US 60/746,516
(51) C01G 39/06 (2006.01), C10M 173/02 (2006.01), C10M 169/06 (2006.01)
(54) ADITIVO ANTIOXIDANTE PARA COMPOSIÇÕES LUBRIFICANTES, QUE
COMPREENDEM COMPOSTOS DE ORGANOTUNGSTATO, DIARIL AMINA E
ORGANOMOLIBDÊNIO
(57) COMPREENDEM COMPOSTOS DE ORGANOTUNGSTATO, DIARIL
AMINA E ORGANOMOLIBDENIO. Uma composição de óleo lubrificante contém
uma porção maior de um óleo base lubrificante e um aditivo antioxidante em
aproximadamente 0,1 - 5,0 por cento em massa, o aditivo incluindo: uma diaril
amina secundária, um composto de organo molibdênio e um composto de
tungstato de organoamônio.
(71) R.T. Vanderbilt Company, INC. (US)
(72) Robert John Tynik, Steven G. Donnelly, Gaston A. Aguilar
(74) Montaury Pimenta, Machado & Lioce S/C Ltda
(85) 08/09/2008
(86) PCT US2007/068135 de 03/05/2007
(87) WO WO2007/131104 de 15/11/2007
RPI 2109 de 07/06/2011
(21) PI 0708630-0 A2 (22) 02/05/2007
1.3
(30) 05/05/2006 US 60/746,515
(51) C10M 163/00 (2006.01)
(54) COMPOSIÇÕES ANTIOXIDANTES LUBRIFICANTES QUE EMPREGAM
COMPONENTE DE ORGANOTUNGSTATO SINERGÍSTICO
(57) COMPOSIÇÔES ARTIOXIDANTES LUBRIFICANTES QUE EMPREGAM
COMPONENTE DE ORGANOTUNGSTATO SINERGÍSTICO. A invenção
refere-se a um aditivo para aperfeiçoar as capacidades antioxidantes em uma
composição lubrificante, onde a composição lubrificante se baseia em uma
quantidade maior de um óleo lubrificante e 0,1 - 5,0 por cento em massa de um
aditivo, o aditivo incluindo uma diarilamina secundária e um tungstato de
organoamônio.
(71) R.T. Vanderbilt Company, INC. (US)
(72) Robert John Tynik, Steven G, Donnelly, Gaston A. Aguilar
(74) Montaury Pimenta, Machado & Lioce S/C Ltda
(85) 08/09/2008
(86) PCT US2007/068017 de 02/05/2007
(87) WO WO2007/131027 de 15/11/2007
(21) PI 0708631-8 A2 (22) 15/02/2007
1.3
(30) 08/03/2006 US 60/780.115
(51) C08G 18/08 (2006.01), C08G 18/10 (2006.01), C08G 18/42 (2006.01),
C08K 5/00 (2006.01), C08K 5/18 (2006.01)
(54) COMPOSIÇÃO DE POLIURETANO ESCOÁVEL DE ARMAZENAMENTO
ESTÁVEL, MÉTODO PARA ARMAZENAR UMA COMPOSIÇÃO DE
POLIURETANO CURÁVEL E PRODUTO DE ELASTÔMERO DE
POLIURETANO
(57) COMPOSIÇÃO DE POLIURETANO ESCOÁVEL DE ARMAZENAMENTO
ESTÁVEL, MÉTODO PARA ARMAZENAR UMA. COMPOSIÇÃO DE
POLIURETANO CURÁVEL E PRODUTO DE ELASTÔMERO DE
POLIURETANO. Em um aspecto, a presente invenção refere-se a um
prepolímero de poliuretano escoável de armazenamento estável
compreendendo (a) um ou mais prepolímeros de poliuretano terminados em
isocianato derivados de um ou mais diisocianatos e/ou triisocianatos contendo
anel de hidrocarboneto e um ou mais poliáis; (b) um ou mais complexos de
metal de sal dimetilenodianilina; e (c) um ou mais compostos de haleto de ácido
orgânico tendo um ou mais grupos de haleto de ácido, em gue um ou mais
compostos de haleto de ácido orgânico estão em uma guantidade em gue os
grupos de haletos de ácido estão presentes em uma concentração mínima de
cerca de 100 partes por milhão em peso do prepolímero de poliuretano. Em
outro aspecto, a invenção refere-se a métodos para armazenamento de
composições de poliuretano curáveis, assim como produção de elastâmeros de
poliuretano.
(71) Chemtura Corporation (US)
(72) Phaniraj T. Nagaraj, R. Scott Archibald, Thomas R. Doyle, Ronald O.
Rosenberg
(74) Bhering Advogados
(85) 08/09/2008
(86) PCT US2007/004393 de 15/02/2007
(87) WO WO2008/136788 de 13/11/2008
(21) PI 0708636-9 A2 (22) 06/03/2007
1.3
(30) 06/03/2006 DK PA 2006 00324; 14/12/2006 US 60/874,716
(51) C07K 16/10 (2006.01), A61K 39/42 (2006.01), A61P 31/14 (2006.01)
(54) ANTICORPO POLICLONAL RECOMBINANTE PARA TRATAMENTO DE
INFECÇÕES POR VÍRUS SINCICIAIS RESPIRATÓRIOS
(57) ANTICORPO POLICLONAL RECOMBINANTE PARA TRATAMENTO DE
INFECÇÕES POR VIRUS SINCICIAIS RESPIRATÓRIOS. A presente invenção
refere-se a anticorpos policlonais, que direcionam vírus sincicial respiratório
(RSV), e novas moléculas de anticorpo de alta afinidade reativas com RSV. Os
anticorpos policlonais podem compreender moléculas que são reativas com
ambas a proteína F de RSV e a proteína G de RSV, e, preferivelmente, os
anticorpos policlonais direcionam uma variedade de epítopos sobre estas
proteínas. As moléculas de anticorpos simples mostram possuírem afinidades
que proporcionam constantes de dissociação na faixa picomolar. Também
descritos estão métodos para produzir os anticorpos da invenção bem como
métodos de seu uso no tratamento de infecção por RSV.
(71) Symphogen A/S (DK)
(72) Johan Lantto, Lucilla Steinna, Klaus Koefoed, Lars S. Nielsen, Henriette
Schjonning Nielsen
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT DK2007/000113 de 06/03/2007
(87) WO 2007/101441 de 13/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 71
(21) PI 0708637-7 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 US 11/369613
(51) B01D 61/02 (2006.01), B01D 61/36 (2006.01), B01D 71/36 (2006.01),
B01D 71/38 (2006.01), C01B 17/92 (2006.01)
(54) MÉTODOS PARA A RECUPERAÇÃO DE ÁCIDO E, PARA A
RECONSTITUIÇÃO DE UM ÁCIDO
(57) MÉTODOS PARA A RECUPERAÇÃO DE ÁCIDO, E PARA A
RECONSTITUIÇÃO DE UM ÁCIDO. Uma membrana de sulfato polivinílico
polimérico reticulada ou membrana de sulfato polivinílico e álcool polivinílico
reticulada, ou Nafion® ou politetrafluoroetileno adequados para uso em um
ambiente ácido, e seu uso para recuperar ou reconstituir ácido de uma mistura
alimentícia compreendendo predominantemente ácido e água, o método
compreendendo: processar referida mistura com o uso de uma primeira
membrana polimérica tal como Nafion® ou politetrafluoroetileno ('PTFE') por
exemplo, para formar um primeiro retido contendo uma concentração
substancialmente mais elevada de ácido do que a referida mistura alimentícia e
um primeiro permeado contendo uma concentração substancialmente mais
elevada de água do que a referida mistura, referida primeira membrana
polimérica seletivamente excluindo a permeância do ácido da água encontrada
na mistura, e recuperando o primeiro retido; referido primeiro retido pode ser
processado ainda com o uso de um segundo meio de sistema de membrana de
redução de água para formar uma corrente de retido contendo uma
concentração substancialmente mais elevada de ácido do que o primeiro retido,
e uma segunda corrente contendo uma concentração substancialmente mais
elevada de água do que o referido primeiro retido; e recuperar o retido ácido.
(71) Exxonmobil Research And Engineering Company (US)
(72) Ramon A. Strauss, Tomas R. Melli, John H. Hollenbach, Bhupender S.
Minhas
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/005599 de 06/03/2007
(87) WO 2007/103314 de 13/09/2007
(21) PI 0708638-5 A2 (22) 27/02/2007
1.3
(30) 06/03/2006 US 60/779,466; 31/03/2006 US 60/788,517; 19/05/2006 US
11/437,904; 28/12/2006 US 11/617,076
(51) A61M 39/00 (2006.01), A61J 1/14 (2006.01)
(54) ADAPTADORES PARA USO COM VAPORIZADOR ANESTÉSICO
(57) ADAPTADORES PARA USO COM UM VAPORIZADOR ANESTÉSICO. A
presente invenção se refere a adaptadores que são proporcionados para
estabelecer comunicação de fluido entre um recipiente de agente anestésico e
um vaporizador de anestésico dotado de um orifício de fluido. O adaptador pode
ser capaz de ser montado em um vaporizador para cooperar com o bico de um
recipiente de agente anestésico ou pode ser capaz de ser montado em um
recipiente de agente anestésico para cooperar com o orifício de fluido do
vaporizador de anestésico para proporcionar uma relação de vedação e/ou de
retenção entre os mesmos.
(71) Baxter International INC (US) , Baxter Healthcare S.A (CH)
(72) Simon Freed, Alan Marttila, Timothy B. Meluch, Michael R. Prisco, John
Depiano, David Chesley, Eric Hyman, Richard P. Meyst, Roy T. Henderson,
Raymond D. Clark
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT US2007/062855 de 27/02/2007
(87) WO 2007/103658 de 13/09/2007
72
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(51) A61K 9/24 (2006.01)
(54) COMPOSIÇÃO FARMACÊUTICA, E, MÉTODOS PARA TRATAR UM
PACIENTE COM DOR DE CABEÇA DE ENXAQUECA, PARA TRATAR UM
PACIENTE COM DOR E PARA TRATAR UM PACIENTE COM ENXAQUECA
(57) COMPOSIÇÃO FARMACÊUTICA, E, METODOS PARA TRATAR UM
PACIENTE COM DOR DE CABEÇA DE ENXAQUECA, PARA TRATAR UM
PACIENTE COM DOR E PARA TRATAR UM PACIENTE COM ENXAQUECA.
A presente invenção diz respeito a formas de dosagem que podem ser usadas
em métodos terapêuticos que envolvem a co-administração oral de uma
combinação de pelo menos dois medicamentos, um dos quais prejudica a
absorção gastrintestinal e um dos quais não prejudica. As formas de dosagem
são projetadas de maneira tal que o medicamento que prejudica a absorção
não é liberado no trato gastrintestinal de um paciente até que os medicamentos
que não prejudicam a absorção tenham sido liberados e substancialmente
absorvidos. A invenção pode ser usada no tratamento de enxaqueca usando
uma combinação de triptanos e NSAIDs ou no tratamento de dor usando uma
combinação de NSAIDs e analgésicos opióides.
(71) Pozen INC. (US)
(72) John R. Plachetka, Donna L. Gilbert
(74) Momsen, Leonardos & CIA.
(85) 05/09/2008
(86) PCT US2007/005266 de 02/03/2007
(87) WO 2007/103113 de 13/09/2207
(21) PI 0708639-3 A2 (22) 09/02/2007
1.3
(30) 06/03/2006 DE 10 2006 0110644.5
(51) F02N 11/08 (2006.01), F02N 15/06 (2006.01)
(54) DISPOSITIVO COM UMA PRIMEIRA SEÇÃO DE ENGRENAGEM PARA
ENGRANZAMENTO EM UMA SEGUNDA SEÇÃO DE ENGRENAGEM,
ESPECIALMENTE DISPOSITIVO DE PARTIDA, COM UM PINHÃO PARA
ENGRANZAR EM UMA COROA DENTADA DE UM MOTOR DE
COMBUSTÃO, BEM COMO PROCESSO PARA OPERAR UM DISPOSITIVO
DESTE GÊNERO
(57) DISPOSITIVO COM UMA PRIMEIRA SEÇÃO DE ENGRENAGEM PARA
ENGRANZAMENTO EM UMA SEGUNDA SEÇÃO DE ENGRENAGEM,
ESPECIALMENTE DISPOSITIVO DE PARTIDA, COM UM PINHÃO PARA
ENGRANZAR EM UMA COROA DENTADA DE UM MOTOR DE
COMBUSTÃO, BEM COMO PROCESSO PARA OPERAR UM DISPOSITIVO
DESTE GÊNERO. A presente invenção refere-se a um dispositivo com uma
primeira seção de engrenagem (23) para engranzamento em uma segunda
seção de engrenagem (26), especialmente um dispositivo de partida com um
pinhão para engranzar em uma coroa dentada de um motor de combustão (29),
caracterizado pelo fato de que está previsto ao menos um meio (56,10, 53, 45),
pelo qual pode ser determinado um estado de mobilidade da primeira seção de
engrenagem (23) e um estado de mobilidade da segunda seção de
engrenagem (26). Processo para operar um dispositivo (20) com uma primeira
seção de engrenagem (23) para engranzamento em uma segunda seção de
engrenagem (26), especialmente dispositivo de partida com um pinhão para
engranzar em uma coroa dentada de um motor de combustão (29),
caracterizado pelo fato de que está previsto ao menos um meio (56, 53, 45),
pelo qual são determinados um estado de mobilidade da primeira seção de
engrenagem (23) e um estado de mobilidade da primeira seção de engrenagem
(23), bem como um estado de mobilidade da segunda seção de engrenagem
(26).
(71) Robert Bosch GMBH (DE)
(72) Klaus Heyers, Jie Ge, Apostolos Tsakiris, Jochen Heusel, Martin Neuburger
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 05/09/2008
(86) PCT EP2007/051281 de 09/02/2007
(87) WO 2007/101770 de 13/09/2007
(21) PI 0708640-7 A2 (22) 02/03/2007
(30) 06/03/2006 US 60/779373; 02/03/2007 US 11/712969
1.3
(21) PI 0708641-5 A2 (22) 07/03/2007
1.3
(30) 08/03/2006 US 60/780,326; 19/01/2007 US 11/625,031
(51) B21B 37/16 (2006.01), B21B 37/28 (2006.01)
(54) MÉTODO PARA CONTROLAR GEOMETRIA DE TIRA EM UMA USINA
DE FUNDIÇÃO DE TIRA, ARQUITETURA DE CONTROLE PARA CONTROLE
A GEOMETRIA DE TIRA E MÉTODO PARA PRODUZIR TIRA FUNDIDA FINA
(57) MÉTODO PARA CONTROLAR GEOMETRIA DE TIRA EM UMA USINA
DE FUNDIÇAO DE TIRA, ARQUITETURA DE CONTROLE PARA
CONTROLAR A GEOMETRIA DE TIRA E MÉTODO PARA PRODUZIR TIRA
FUNDIDA FINA. Expõe-se um aparelho e método para controlar geometria de
tira em uma usina de fundição que é dotada de um laminador. Um perfil de
espessura visado é calculado como uma função do perfil de espessura de
entrada medida da tira enquanto satisfaz requisitos operacionais de perfil e
lisura. Uma realimentação de tensão diferencial proveniente da tensão
longitudinal na tira é calculada por um sistema de controle pela comparação do
perfil de espessura de saída com o perfil de espessura visado, e um sinal de
controle é gerado para controlar um dispositivo capaz de afetar a geometria da
tira processada pela usina de laminação. Uma referência de controle de
alimentação de avanço e/ou vetor de sensibilidade pode ser também calculado
como uma função do perfil de espessura visado, e usada na geração do sinal
de controle enviado para o dispositivo de controle. O dispositivo de controle
pode ser selecionado a partir de um ou mais do grupo que consiste de um
controlador de flexão, controlador de distância intercalar (flexão) e controlador
de refrigerante.
(71) Nucor Corporation (US)
(72) Jason A. Mueller, Harold Bradley Rees, Glew Wallace, Richard Britanik,
Tino Domanti, Terry L. Gerber
(74) Vieira de Mello, Werneck Alves - Advogados S/C
(85) 08/09/2008
(86) PCT AU2007/000289 de 07/03/2007
(87) WO 2007/101308 de 13/09/2007
(21) PI 0708642-3 A2 (22) 03/03/2007
(30) 09/03/2006 DE 20 2006 003 897.3
(51) F16J 15/32 (2006.01)
1.3
RPI 2109 de 07/06/2011
(54) VEDAÇÃO DE EIXO RADIAL
(57) VEDAÇÃO DE EIXO RADIAL. A presente invenção refere-se a uma
vedação de eixo radial para a vedação de um espaço interno (20) fechado,
preenchido com um meio fluido em um eixo (12) em rotação contra a atmosfera
(30) externa, com pelo menos um corpo de membrana (4) que possui uma
membrana de vedação (8) com um lábio de vedação (9) em contato vedante
com o eixo (12) e em posição inclinada contra o espaço interno (20), sendo que
a membrana de vedação, no lado afastado do espaço interno (20), é apoiado
por um elemento de suporte (3), que com sua borda (3r) voltada para o eixo
forma com esta uma fenda anelar, é previsto que o elemento de suporte (3),
pelo menos na área de borda (3r) vizinha ao eixo (12), consiste em um material
sintético não elástico e que a largura d da fenda anelar (14) entre a borda (3r)
do elemento de suporte (3) e o eixo (12) é dimensionado de tal modo que ao
aspirar o ar do espaço interno (20) contra o ar que entra através da fenda
anelar (14) pode ser alcançada uma pressão de no máximo 20 hPa no espaço
interno (20).
(71) VR Dichtungen GmbH (DE)
(72) Siegmar Kreutzer, Franz Pawellek
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT DE2007/000399 de 03/03/2007
(87) WO 2007/101429 de 13/09/2007
(21) PI 0708643-1 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 US 60/779,779
(51) A61K 8/41 (2006.01), A61K 8/49 (2006.01), A61K 8/58 (2006.01), A61Q
5/10 (2006.01)
(54) COMPOSIÇÕES PARA TINGIMENTO DE FIBRAS DE QUERATINA POR
OXIDAÇÃO E MÉTODOS PARA USO DE TAIS COMPOSIÇÕES
(57) COMPOSIÇÕES PARA TINGIMENTO DE FIBRAS DE QUERATINA POR
OXIDAÇÃO E MÉTODOS PARA USO DE TAIS COMPOSIÇÕES. Composições
para tingimento de fibras de queratina que compreendem (a) pelo menos um
composto para tingimento de queratina selecionado a partir de sistemas
aromáticos que compreendem ao menos um ácido borônico ou porção de éster
borônico e que são capazes de formar, por oxidaçào, um nucleófiío ou um
eletrófilo, (b) pelo menos um composto para tingimento de queratina adicional
selecionado do grupo consistindo em reveladores auxiliares e acopladores
auxiliares e (c) um meio cosmeticamente adequado. Métodos para tingimento
oxidante de fibras de queratina que compreendem as etapas de aplicação de
tais composições na presença de um agente oxidante e enxágue do cabelo. Um
produto para tingimento dos cabelos na forma de kit que compreende um
prifleiro recipiente embalado separadamente que compreende uma composição
conforme descrito acima e um segundo recipiente embalado separadamente
que compreende um agente oxidante.
(71) The Procter & Gamble Company (US)
(72) Mu'lll Lim, Guiru Zhang, Margaret Popp, Bryan Patrick Murphy
(74) Trench , Rossi & Watanabe Advogados
(85) 08/09/2008
(86) PCT IB2007/050747 de 06/03/2007
(87) WO 2007/102126 de 13/09/2007
(21) PI 0708644-0 A2 (22) 05/03/2007
1.3
(30) 07/03/2006 US 60/779,851
(51) C07D 487/04 (2006.01), A61K 31/53 (2006.01), A61P 29/00 (2006.01),
C07C 11/00 (2006.01)
(54) COMPOSTOS DE PRÓ-FÁRMACO DE ANILINA DE PIRROLOTRIAZINA
ÚTEIS COMO INIBIDORES DE CINASE
(57) COMPOSTOS DE PRO-FÁRMACO DE ANILINA DE PIRROLOTRIAZINA
ÚTEIS COMO INIBIDORES DE CINASE. A presente invenção refere-se a
compostos tendo a Fórmula (I), incluindo sais farmaceuticamente aceitáveis dos
mesmos, em que pelo menos um dentre X1, X2 ou X3 é hidrogênio, que são
úteis como inibidores de cinase, em que R1, R2, R3. R4, R5, R6, R7, A1, A2 e m
são como descritos aqui.
(71) Bristol-Myers Squibb Company (US)
(72) Chunjian Liu, Katherina Leftheris, Vivekananda M. Vrudhula, James Lin
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 73
(85) 08/09/2008
(86) PCT US2007/063250 de 05/03/2007
(87) WO 2007/103839 de 13/09/2007
(21) PI 0708645-8 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/779,862; 08/03/2006 US 60/780,277
(51) A61K 31/455 (2006.01), A61K 31/519 (2006.01), A61K 39/395 (2006.01),
A61P 19/02 (2006.01), A61P 29/00 (2006.01)
(54) COMPOSIÇÕES E MÉTODOS PARA O TRATAMENTO DE ARTRITE
REUMATÓIDE
(57) COMPOSIÇÕES E MÉTODOS PARA O TRATAMENTO DE ARTRITE
REUMATOIDE. A presente invenção refere-se aos métodos e composições
para o tratamento de RA em indivíduos com a necessidade do mesmo. A
invenção também refere-se aos kits e embalagens farmacêuticas
compreendendo composições e formas de dosagem.
(71) Vertex Pharmaceuticals Incorporated (US)
(72) Ramon Mohanlai, Robert Stephen Kauffman, John J. Alam, Irina Kadiyala
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005882 de 07/03/2007
(87) WO 2007/103468 de 13/09/2007
(21) PI 0708646-6 A2 (22) 06/03/2007
1.3
(30) 08/03/2006 FI 20065153
(51) A01G 9/24 (2006.01), F24F 3/14 (2006.01)
(54) ARRANJO E MÉTODO PARA DESUMIDIFICAR O AR DE ESTUFA E
UMA ESTUFA
(57) ARRANJO E MÉTODO PARA DESUMIDIFICAR O AR DE ESTUFA E
UMA ESTUFA. Um sistema para secagem e esfriamento do ar de estufa, o
sistema compreendendo meio de distribuição de água (1), por intermédio do
qual água mais fria do que a temperatura de ponto de orvalho da estufa pode
ser pulverizada diretamente para seu espaço de ar sem câmaras
condensadoras, estruturas e ventiladores, separados.
(71) Biolan Oy (FI)
(72) Markku Haukioja, Jukka Huttunem, Esko Huhta-Koivisto
(74) Orlando de Souza / OAB: 0474
(85) 08/09/2008
(86) PCT FI2007/050121 de 06/03/2007
(87) WO 2007/101914 de 13/09/2007
(21) PI 0708647-4 A2 (22) 02/03/2007
1.3
(30) 06/03/2006 US 11/368,906
(51) G01V 1/28 (2006.01), G01V 3/18 (2006.01)
(54) CONTROLE DE QUALIDADE DE DADOS EM TEMPO REAL E
DETERMINAÇÃO DE ÂNGULOS DE FORMAÇÃO A PARTIR DE MEDIÇÃO
DE INDUÇÃO DE MÚLTIPLOS COMPONENTES UTILIZANDO REDES
NEURAIS
(57) CONTROLE DE QUALIDADE DE DADOS EM TEMPO REAL E
DETERMINAÇÃO DE ÂNGULOS DE FORMAÇÃO A PARTIR DE MEDIÇÃO
74
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
DE INDUÇÃO DE MÚLTIPLOS COMPONENTES UTILIZANDO REDES
NEURAIS. A presente invenção refere-se a redes neurais que podem ser
usadas para determinar e prever a formação de ângulos de inclinação e realizar
avaliações de garantia de qualidade a partir dos dados coletados por uma
ferramenta de indução com múltiplos componentes usadas para perfilagem de
poços. As redes neurais fazem uso de dados corrigidos, rotacionados e
normalizados para proporcionar previsões e avaliações. Os dados sintéticos
que utilizam vários modelos são usados para treinar as redes neurais. Os
ensinamentos da presente invenção fornecem determinações em tempo real
com um grau substancial de precisão nos resultados.
(71) Baker Hughes Incorporated (US)
(72) Sheng Fang, Leonty Tabarovsky, Michael Rabinovich, Liming Yu
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005545 de 02/03/2007
(87) WO 2007/103285 de 13/09/2007
(21) PI 0708648-2 A2 (22) 23/02/2007
1.3
(30) 09/03/2006 IT RM2006 A 000123
(51) H01H 71/02 (2006.01), H02B 1/06 (2006.01)
(54)
EQUIPAMENTO
ELÉTRICO
COM
PORÇÃO
FRONTAL
RECONFIGURÁVEL
(57)
EQUIPAMENTO
ELÉTRICO
COM
PORÇÃO
FRONTAL
RECONFIGURÁVEL. A presente invenção refere-se a um equipamento elétrico
(1) a ser instalado em um quadro de distribuição elétrica provido com um painel
no qual é definida uma janela substancialmente quadrangular, o equipamento
elétrico (1) incluindo um corpo substancialmente na forma de caixa (2) com uma
porção frontal (3) que se projeta a partir de uma face (4) do dito corpo (2)
apresentando uma primeira dimensão (Hi) substancialmente similar a um lado
da janela quadrangular, de tal modo que a dita porção frontal (3) possa ser
recebida dentro da dita janela, caracterizado pelo fato de a porção frontal (3)
incluir um elemento de ajuste (5) que pode ser removivelmente associado com
a dita face (4) do dito corpo na forma de caixa (2) para reconfigurar a dita
porção frontal (3) em variando a dita primeira dimensão (H1).
(71) Bticino S.P.A. (IT)
(72) Fabrizio Fabrizi
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT IT2007/000127 de 23/02/2007
(87) WO 2007/102180 de 13/09/2007
(21) PI 0708649-0 A2 (22) 14/02/2007
(30) 07/03/2006 EP 06 290386.9
1.3
RPI 2109 de 07/06/2011
(51) C22C 38/02 (2006.01), C22C 38/04 (2006.01), C22C 38/06 (2006.01),
C22C 38/34 (2006.01), C22C 38/38 (2006.01), C21D 1/19 (2006.01)
(54) PROCESSO PARA FABRICAÇÃO DE CHAPA DE AÇO TENDO LIMITE
DE RESISTÊNCIA À TRAÇÃO CARACTERÍSTICAS DE DUCTILIDADE E
TENACIDADE MUITO ALTAS, E CHAPA ASSIM PRODUZIDA
(57) PROCESSO PARA FABRICAÇÃO DE CHAPA DE AÇO TENDO LIMITE
DE RESISTÊNCIA À TRAÇÃO, CARACTERISTICAS DE DUCTILIDADE E
TENACIDADE MUITO ALTAS, E CHAPA ASSIM PRODUZIDA. A presente
invenção refere-se a uma chapa de aço laminada a quente tendo um limite de
resistência à tração maior que 1200 MPa, uma razão ReIRm de menos de 0,75
e um alongamento na fratura maior que 10%, cuja composição contém, os
teores estando em % em peso: 0,10%  C  0,25%; 1%  Mn  3%; AI 
0,015%; Si  1,985; Mo  0,30%; Cr  1,5%; S  0,015%; P  0,1%; Co  1,5%;
B  0,005%; sendo entendido que 1%  Si + AI  2%; Cr + (3 x Mo)  0,3%, o
saldo da composição consistindo em ferro e as inevitáveis impurezas
resultantes da fusão, a microestrutura do aço consistindo em pelo menos 75%
de bainita, austenita residual em uma quantidade igual a, ou maior que, 5% e
martensita em uma quantidade igual a, ou maior que, 2%.
(71) Arcelormittal France (FR)
(72) Sébastien Allan, Audrey Couturier, Thierry Lung, Christine Colin
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT FR2007/000256 de 14/02/2007
(87) WO 2007/101921 de 13/09/2007
(21) PI 0708650-4 A2 (22) 23/02/2007
1.3
(30) 10/03/2006 FR 0650811
(51) C03C 17/34 (2006.01), B32B 17/10 (2006.01), E06B 3/67 (2006.01), G02B
1/11 (2006.01)
(54)
SUBSTRATO
TRANSPARENTE,
NOTADAMENTE
VÍTREO,
COMPORTANDO UM REVESTIMENTO ANTI-REFLEXO, VRIDRAÇA
MÚLTIPLA, NOTADAMENTE DUPLA OU DE ESTRUTURA LAMINADA E
APLICAÇÃO DE UM SUBSTRATO
(57)
SUBSTRATO
TRANSPARENTE,
NOTADAMENTE
VÍTREO,
COMPORTANDO
UM
REVESTIMENTO
ANTI-REFLEXO,
VIDRAÇA
MULTIPLA, NOTADAMENTE DUPLA OU DE ESTRUTURA LAMINADA E
APLICAÇÃO DE UM SUBSTRATO. Substrato transparente (6), notadamente
vítreo, que compreende em pelo menos uma de suas faces um revestimento
anti-reflexo feito de um empilhamento (A) de camadas finas feitas de material
dielétrico com índices de refração alternativamente altos e baixos, caracterizado
pelo fato de que o empilhamento compreende sucessivamente: - uma primeira
camada (1) de alto índice, de índice de refração n1 compreendido entre 1,8 e
2,3 e de espessura geométrica e1 compreendida entre 10 e 25 nm,-uma
segunda camada (2) de baixo índice, de índice de refração n2 compreendido
entre 1,40 e 1,55 e de espessura geométrica e2 compreendida entre 20 e 50
nm, - uma terceira camada (3) de alto índice, de índice de refração n3
compreendido entre 1,8 e 2,3 e de espessura geométrica e3 compreendida
entre 110 e 150 nm, - uma quarta camada (4) de baixo índice, de índice de
refração n4 compreendido entre 1,40 e 1,55 e de espessura geométrica e4
compreendida entre 60 e 95 nm, a soma algébrica das espessuras geométricas
e3 + e1 sendo compreendida entre 125 e 160 nm.
(71) Saint-Gobain Glass France (FR)
(72) Vincent Reymond, Estelle Martin
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT FR2007/050842 de 23/02/2007
(87) WO 2007/104874 de 20/09/2007
(21) PI 0708652-0 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/780,037
(51) F04B 17/03 (2006.01)
(54) DISPOSITIVOS DE TRANSFERÊNCIA DE ENERGIA FLUÍDICA
(57) DISPOSITIVOS DE TRANSFERÊNCIA DE ENERGIA FLUÍDICA. A
presente invenção refere-se a um dispositivo de transferência de energia
fluídica, que inclui uma câmara para receber um fluido, sendo que ao menos
uma porção da câmara compreende uma porção móvel em relação à outra
porção da câmara, sendo que a porção móvel é adaptada para alterar o volume
da câmara a partir de um primeiro volume para um segundo volume através do
movimento da porção móvel, O dispositivo inclui, ainda, um atuador fixado à
porção móvel, em que os deslocamentos da porção móvel podem ser maiores
que o deslocamento do atuador.
(71) Influent Corp. (US)
(72) Timothy S. Lucas
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005713 de 07/03/2007
(87) WO 2007/103384 de 13/09/2007
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 75
localização para pelo menos um poço. Com base na análise, um ou mais poços
podem ser perfurados e hidrocarboneto produzido.
(71) Federal-Mogul Corporation (US)
(72) Michael J. Anderson, David M. Toth, Gerald A. Greca
(74) Momsen, Leonardos & Cia.
(85) 08/09/2008
(86) PCT US2007/063549 de 08/03/2007
(87) WO 2007/104002 de 13/09/2007
(21) PI 0708653-9 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 US 60/780,296; 29/09/2006 US 11/536,756
(51) C08K 5/00 (2006.01), C08K 5/098 (2006.01), C07C 61/13 (2006.01)
(54) COMPOSIÇÕES ADITIVAS DE AGENTE DE NUCLEAÇÃO E MÉTODOS
(57) COMPOSIÇÕES ADITIVAS DE AGENTE DE NUCLEAÇÃO E MÉTODOS.
A presente invenção trata da mistura de dois diferentes compostos que podem
ser aplicados juntos, de modo a formar uma composição aditiva de agente de
nucleação. Essa composição aditiva é de utilidade como um aditivo em
termoplásticos, poliolefinas e/ou resinas de polímero. Uma mistura de um sal de
biciclo[2.2.1]heptano dicarboxilato e um sal metálico de dicarboxilato de cálcio
proporciona úteis e benéficos efeitos de propriedade física em artigos
poliméricos moldados, em termos de contração e temperatura de cristalização
das composições de resina polimérica.
(71) Milliken & Company (US)
(72) Weihua Sonya Wolters, Robbie Willem Johan M. Hanssen, Thaneerpandal
K. Palanisami, Darin L. Dotson
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/006099 de 08/03/2007
(87) WO 2007/103571 de 13/09/2007
(21) PI 0708654-7 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 EP 06 290379.4
(51) C07D 209/60 (2006.01), C07D 401/14 (2006.01), A61K 31/404 (2006.01),
A61K 31/4439 (2006.01), A61P 35/00 (2006.01)
(54) PRÓ-FÁRMACOS MELHORADOS DE ANÁLOGOS DE CC-1065
(57) PRÓ-FÁRMACOS MELHORADOS DE ANÁLOGOS DE CC-1065. A
presente invenção refere-se a prá-fármacos de análogos do antibiótico
antitumoral CC-1 065 tendo um grupo protetor clivável contendo um ácido
sulfônico contendo carbamato de fenila, no qual o grupo de proteção confere
uma solubilidade em água melhorada em relação ao pró-fármaco, e no qual o
pró-fármaco também tem uma porção, tal como um sulfeto ou um dissulfeto,
que pode se conjugar a um reagente de aglutinação celular, tal como um
anticorpo. O uso terapêutico de tal conjugado de pró-fármaco também é
descrito; tais pró-fármacos de agentes citotóxicos possuem uso terapêutico
porque podem liberar os pró-fármacos citotóxicos em uma população específica
de células para a conversão enzimática no fármaco citotóxico de um modo
especificamente destinado.
(71) Sanofi-Aventis (FR)
(72) Robert Zhao, Ravi Chari
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT IB2007/000521 de 06/03/2007
(87) WO 2007/102069 de 13/09/2007
(21) PI 0708655-5 A2 (22) 08/03/2007
1.3
(30) 09/03/2006 US 11/371405
(51) F16C 32/00 (2006.01)
(54) CONJUNTO DE FUSO ROTATIVO E CUBO ROTATIVO LUBRIFICADO
EM ÓLEO, VEDAÇÃO DE BANHO DE ÓLEO, MÉTODO PARA SUBSTITUIR
UMA VEDAÇÃO DE BANHO DE ÓLEO, E, CONJUNTO DE VEDAÇÃO
(57) CONJUNTO DE FUSO ROTATIVO E CUBO ROTATIVO LUBRIFICADO
EM ÓLEO, VEDAÇÃO DE BANHO DE ÓLEO, MÉTODO PARA SUBSTITUIR
UMA VEDAÇÃO DE BANHO DE ÓLEO, E, CONJUNTO DE VEDAÇÃO. A
presente invenção descreve um método e sistema associados à produção de
hidrocarboneto. No método, modelos de escoamento de fluido e tempo são
construídos a partir de um modelo de reservatório. Depois, medidas de
conectividade de reservatório são calculadas a partir de modelos de
escoamento de fluido e tempo e analisadas para a determinação de uma
(21) PI 0708656-3 A2 (22) 06/03/2007
1.3
(30) 06/03/2006 US 11/369,070
(51) B65H 3/58 (2006.01)
(54) BOLSA DESTACÁVEL APERFEIÇOADA QUE CONTÉM UMA ÚNICA
DOSAGEM DE FILME E PROCESSO PARA FABRICAR A MESMA
(57) BOLSA DESTACÁVEL APERFEIÇOADA QUE CONTÉM UMA ÚNICA
DOSAGEM DE FILME E PROCESSO PARA FABRICAR A MESMA. A presente
invenção refere-se a uma bolsa destacável para conter um produto de dosagem
única que tem uma camada superior unida a uma camada inferior por uma
vedação de contenção e uma vedação de distribuição formada com um
elevador de tensão que separa o compartimento primário do compartimento
secundário, O compartimento primário aloja o produto, vedado do ambiente
externo, O compartimento secundário inclui uma linha de dobramento. Quando
a bolsa dobrada ao redor da linha de dobramento a condição de superfície de
promoção de rasgamento permite ao usuário rasgar facilmente uma porção da
bolsa e expor uma porção do compartimento secundário. O produto é acessado
destacando o compartimento secundário, a vedação de distribuição, e então
destacando aberto o compartimento primário. As modalidades preferidas
incorporam variações das espessuras de vedação de contenção primária e
secundária.
(71) R.P. Scherer Technologies, Inc. (US)
(72) David Barndt, Michael S. Bergey, Victor Gherdan
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005574 de 06/03/2007
(87) WO 2007/106338 de 20/09/2007
(21) PI 0708657-1 A2 (22) 23/02/2007
1.3
(30) 09/03/2006 FR 0602091
(51) A61K 31/575 (2006.01), A61P 9/00 (2006.01)
(54) UTILIZAÇÃO DE PELO MENOS UM COMPOSTO
(57) UTILIZAÇÃO DE PELO MENOS UM COMPOSTO. A presente invenção se
refere à utilização de derivados do 3,5-seco-4-nor-colestano para a obtenção de
um medicamento citoprotetor, a exceção de um medicamento neuroprotetor,
notadamente um medicamento cardioprotetor ou hepatoprotetor.
(71) Trophos (FR)
(72) Rebecca Pruss, Bruno Buisson, Thierry Bordet
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT FR2007/000330 de 23/02/2007
(87) WO 2007/101925 de 13/09/2007
(21) PI 0708658-0 A2 (22) 06/07/2007
(30) 31/07/2006 JP 2006-208931
(51) B23G 1/02 (2006.01), G05B 19/418 (2006.01)
1.3
76
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(54) MÉTODO E APARELHO PARA O GERENCIAMENTO DE
INFORMAÇÕES DO HISTÓRICO DE PRODUÇÃO DE TUBULAÇÃO OU
TUBO E MÉTODO PARA A PRODUÇÃO DE TUBULAÇÃO OU TUBO COM
ISSO
(57) MÉTODO E APARELHO PARA O GERENCIAMENTO DE
INFORMAÇÕES DO HISTÓRICO DE PRODUÇÃO DE TUBULAÇÃO OU
TUBO E MÉTODO PARA A PRODUÇÃO DE TUBULAÇÃO OU TUBO COM
ISSO. A presente invenção refere-se a um aparelho de gerenciamento de
informação do histórico de produção (100) que compreende: um meio de
usinagem (1) para usinar um identificador para identificar uma tubulação ou
tubo em uma região da tubulação ou tubo no qual deve ser executado o corte
da rosca antes de um processo de produção inicial ser realizado entre os
processos de produção que são alvos de gerenciamento da informação do
histórico de produção; um meio de leitura (2) para ler o identificador usinado na
tubulação ou tubo antes de cada um dos processos de produção ser realizado
ou enquanto cada um dos processos de produção é realizado; um meio de
gerenciamento (3) para armazenar a informação do histórico de produção da
tubulação ou tubo obtida em cada um dos processos de produção e o
identificador lido com o meio de leitura a partir da tubulação ou tubo enquanto a
informação do histórico de produção e o identificador são associados; e um
meio de corte de rosca (4) para remover o identificador usinado na tubulação ou
tubo no processo de execução do corte de rosca nas partes de extremidade da
tubulação ou tubo entre os processos de produção que são alvos de
gerenciamento da informação do histórico de produção.
(71) Sumitomo Metal Industries LTD. (JP)
(72) Mutsumi Tanida
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT JP2007/063547 de 06/07/2007
(87) WO 2008/015871 de 07/02/2008
um fator de transcrição hélice-loop-hélice básico de Arabidopsis (bHLH-04 1), e
fragmentos e variantes destes. A sequência do promotor do ELF3 é útil para
dirigir a expressão de polinucleotideos de interesse em uma planta. As
sequências da invenção ELF3 e bHLH-041, ou variantes e fragmentos destas,
são fornecidas em cassetes de expressão para uso em manipulação da
expressão dos genes ELF3 e bHLH-041. Aumentando a expressão do ELF3
e/ou suprimindo a expressão do bHLH-041, os métodos da invenção permitem
respostas de uma planta à qualidade da luz alteradas e supressão do modo de
desenvolvimento de sobrevivência comandado por alta densidade. A invenção
deste modo fornece métodos para o crescimento de plantas em altas
densidades populacionais para aumento da produção. Plantas transformadas
possuindo o fenótipo de evitar sombra alterado da invenção, e sementes de tais
plantas, são também fornecidas.
(71) Pioneer HI-Bred International, Inc (US) , E.I. Du Pont De Nemours And
Company (US)
(72) Nicholas J. Bate, Milo J. Aukerman
(74) Antonella Carminatti
(85) 08/09/2008
(86) PCT US2007/063445 de 07/03/2007
(87) WO 2007/103956 de 13/09/2007
(21) PI 0708659-8 A2 (22) 27/02/2007
1.3
(30) 08/03/2006 JP 2006-062455
(51) C07C 253/22 (2006.01), C07C 255/03 (2006.01), C07C 209/48 (2006.01)
(54) PROCESSO PARA A PRODUÇÃO DE NITRILAS ALIFÁTICAS
(57) PROCESSO PARA A PRODUÇÃO DE NITRILAS ALIFÁTICAS. A presente
invenção refere-se a um processo para a produção de uma nitrila alifática,
incluindo a etapa de reagir pelo menos um composto selecionado a partir do
grupo que consiste em um ácido monocarboxílico alifático, um ácido
dicarboxílico alifático e ésteres de alquila de tais ácidos que contenham um
grupo alquila tendo de 1 até 5 átomos de carbono, com amônia na presença de
um composto de pelo menos um metal selecionado a partir do grupo que
consiste em zinco, cobalto, titânio e alumínio, e um composto de ácido
sulfônico; e um processo para a produção de uma amina alifática, incluindo a
etapa de submeter a nitrila alifática produzida através do processo acima a uma
reação de hidrogenação na presença de um catalisador de hidrogenação. É
provido um processo industrialmente vantajoso para a produção de uma nitrila
alifática com uma alta reatividade; e um processo para a produção de uma
amina alifática com a utilização da nitrila alifática como a matéria-prima.
(71) Kao Corporation (JP)
(72) Tetsuaki Fukushima, Michio Terasaka
(74) Dannemann, Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT JP2007/054132 de 27/02/2007
(87) WO 2007/102448 de 13/09/2007
(21) PI 0708661-0 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 US 60/780,142; 22/05/2006 US 60/747,853; 26/07/2006 US
60/820,410
(51) C02F 3/00 (2006.01)
(54) SISTEMA E MÉTODO DE TRATAMENTO DE ESGOTO
(57) SISTEMA E MÉTODO DE TRATAMENTO DE ESGOTO. A presente
invenção refere-se a um método e aparelho para tratamento de esgoto. O
sistema de tratamento de esgoto inclui um biorreator (120) incluindo carbono
ativado e uma primeira população biológica. O sistema de tratamento de esgoto
também pode incluir um biorreator de membrana (130) e/ou unidade de
oxidação úmida (150).
(71) Siemens Water Technologies Corp. (US)
(72) Duane R. Smith, Michael Howdeshell, Lori Marten, John A. Meidl, Thomas
J. Vollstedt, Robert J. Wenta, Todd Wingers, Joseph E. Zuback
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005775 de 08/03/2007
(87) WO 2007/103409 de 13/09/2007
(21) PI 0708660-1 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/779,720
(51) C12N 15/82 (2006.01), C07K 14/415 (2006.01)
(54) MÉTODOS PARA MELHORAR A PERFORMANCE DE UMA PLANTA
CRESCIDA EM CONDIÇÕES DE ALTA DENSIDADE POPULACIONAL,
POLINUCLEOTÍDEO ISOLADO, CASSETE DE EXPRESSÃO, PLANTA,
SEMENTE, MÉTODO PARA MODULAR A EXPRESSÃO DE UM
POLINUCLEOTÍDEO DE INTERESSE EM UMA PLANTA
(57) MÉTODOS PARA MELHORAR A PERFORMANCE DE UMA PLANTA
CRESCIDA EM CONDIÇÕES DE ALTA DENSIDADE POPULACIONAL,
POLINUCLEOTIDEO ISOLADO, CASSETE DE EXPRESSAO, PLANTA,
SEMENTE, MÉTODO PARA MODULAR A EXPRESSAO DE UM
POLINUCLEOTIDEO DE INTERESSE EM UMA PLANTA. Composições e
métodos para suprimir a resposta de evitar sombra das plantas e aprimorar a
produção de plantas são fornecidos. Composições da invenção incluem um
gene de florescimento precoce 3 (ELF3) de milho, o promotor para este gene,
(21) PI 0708662-8 A2 (22) 02/03/2007
(30) 07/03/2006 IT MI2006 A 000407
(51) G07D 11/00 (2006.01)
1.3
RPI 2109 de 07/06/2011
(54) DISPOSITIVO E MÉTODO PARA ARMAZENAMENTO E LIBERAÇÃO DE
CÉDULAS BANCÁRIAS
(57) DISPOSITIVO E MÉTODO PARA ARMAZENAMENTO E LIBERAÇÃO DE
CÉDULAS BANCÁRIAS. A presente invenção trata-se a um dispositivo
automático para armazenamento e liberação de cédulas bancárias de um
número de predefinido de categorias que compreende uma entrada (12) para as
cédulas bancárias, meios de reconhecimento (13) para reconhecer a categoria
das cédulas bancárias entrantes, uma pluralidade de carregadores de cilindro
LIFO (14 a 16) para armazenamento das cédulas bancárias, uma saída para as
cédulas bancárias (18), meios de transporte (17) para transportar as cédulas
bancárias entre a entrada, os carregadores e a saída, meios de controle (20)
adequados para controlar os meios de transporte para transferência das
cédulas bancárias da entrada até os carregadores durante a etapa de depósito,
e para a transferência das cédulas bancárias dos carregadores até a saída
durante a etapa de liberação, caracterizado pelo fato de que a quantidade de
carregadores (14 a 16) é menor do que o dito número predefinido de categorias
de cédulas bancárias, os meios de controle (20) compreendem recursos (21 a
23) para o armazenamento da seqúência de categorias armazenadas em cada
carregador, e recursos para controlar os meios de transporte para transferir as
cédulas bancárias de um carregador a outro em função das seqüências
armazenadas e de uma solicitação de liberação registrada no dispositivo, a fim
de permitir que as cédulas bancárias sejam liberadas dos carregadores até a
saída, de acordo com a solicitação.
(71) Cima S.P.A. Di Razzaboni & C. (IT)
(72) Vittorio Razzaboni, Nicoletta Razzaboni
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001809 de 02/03/2007
(87) WO 2007/101621 de 13/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 77
(21) PI 0708664-4 A2 (22) 12/03/2007
1.3
(30) 10/03/2006 US 60/781,222
(51) A46B 5/02 (2006.01)
(54) KIT, E, MÉTODO DE ASSOCIAÇÃO DE PRODUTOS DIFERENTES
(57) KIT, E, METODO DE ASSOCIAÇÃO DE PRODUTOS DIFERENTES. Um
kit e um método para relacionar produtos por intermédio de uma característica
comum, incluem o fornecimento de um primeiro produto tendo uma primeira
característica fornecendo um primeiro beneficiorelevante para o consumidor, e
um segundo produto diferente, tendo uma segunda característica e fornecendo
um segundo beneficio relevante para o consumidor, onde a primeira e a
segunda características têm uma aparência consistente e onde pelo menos
uma característica tem um beneficio relevante para o consumidor em relação à
outra característica.
(71) Colgate-Palmolive Company (US)
(72) Douglas J. Hohlbein, Steven M. Sorrel, Michael C. Rooney
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT US2007/063748 de 12/03/2007
(87) WO 2007/106757 de 20/09/2007
(21) PI 0708663-6 A2 (22) 06/03/2007
1.3
(30) 06/03/2006 US 60/778,848; 04/10/2006 US 60/849,001
(51) B65F 1/14 (2006.01), B65B 67/12 (2006.01), B62B 3/10 (2006.01)
(54) RECIPIENTE DE COLETA COM RODAS PARA DESPEJO
(57) RECIPIENTE DE COLETA COM RODAS PARA DESPEJO. A presente
invenção refere-se a um receptáculo portátil (10) incluindo um recipiente (12)
possuindo um topo aberto e incluindo uma primeira parte (26) que define um
primeiro espaço configurado para receber um primeiro saco e possuindo um
elemento de suporte (20) para suportar pelo menos uma parte da periferia do
primeiro saco, e uma segunda parte (30) que define um segundo espaço
configurado para receber um segundo saco. O receptáculo portátil inclui
adicionaímente um suporte para saco (40) incluindo a estrutura para conexão
ao recipiente de forma que o suporte de saco possa ser disposto entre a
primeira parte e a segunda parte em uma orientação que permita que o suporte
para saco em conjunto com o elemento de suporte suportem pelo menos uma
parte da periferia do primeiro saco de forma que pelo menos uma parte do
primeiro saco seja disposta dentro do primeiro espaço e seja realocada de
modo que o suporte de saco não seja mais disposto entre a primeira parte e a
segunda parte. O receptáculo portátil inclui adicionalmente elementos de
rolamento (50) suportando o recipiente para realizar movimento.
(71) Rubbermaid Commercial Products INC (US)
(72) Donald C. Presnell, Michael Severa
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005633 de 06/03/2007
(87) WO 2007/103339 de 13/09/2007
(21) PI 0708665-2 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 EP 06110879.1
(51) B32B 5/00 (2006.01), A47L 13/16 (2006.01)
(54) SISTEMA DE COMPÓSITO EM CAMADA, PROCESSO PARA PRENDER
UMA OU MAIS CAMADAS A DE UMA ESPUMA DE CÉLULA ABERTA COM
BASE EM UM AMINOPLASTO A UM SUBSTRATO OU PRODUZIR UM
SISTEMA DE COMPÓSITO EM CAMADA, E, USOS DO SISTEMA DE
COMPÓSITO EM CAMADA, E USO DE UMA OU MAIS CAMADAS A DE UMA
ESPUMA DE CÉLULA ABERTA COM BASE EM UM AMINOPLASTO
(57) SISTEMA DE COMIPÓSITO EM CAMADA, PROCESSO PARA PRENDER
UMA OU MAIS CAMADAS A DE UMA ESPUMA DE CÉLULA ABERTA COM
BASE EM UM AMIiNOPLASTO A UM SUBSTRATO OU PRODUZIR UM
SISTEMA DE COMPÓSITO EM CAMADA, E, USOS DO SISTEMA DE
COMPOSITO EM CAMADA, E USO DE UMA OU MAIS CAMADAS A DE UMA
ESPUMA DE CÉLULA ABERTA COM BASE EM UM AMINOPLASTO. Um
sistema de compósito em camada que compreende uma ou mais camadas A)
de uma espuma de célula aberta com base em um aminoplasto e uma ou mais
camadas B) de não tecido fibroso ou de tecido fibroso, em que a dita camada B)
78
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
compreende fibra de melanina, a sua produção e uso como uma esponja de
limpeza ou subcamada protetora.
(71) Basf Se (DE)
(72) Klaus Hahn, Hans-Jürgen Quadbeck-Seeger, Bernhard Vath, Armin
Alteheld, Christof Moeck
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT EP2007/052205 de 09/03/2007
(87) WO 2007/101881 de 13/09/2007
(21) PI 0708666-0 A2 (22) 05/03/2007
1.3
(30) 06/03/2006 US 60/778,909
(51) A01G 9/14 (2006.01), A01G 13/10 (2006.01), A01G 9/24 (2006.01)
(54) ESTUFA HÍBRIDA
(57) ESTUFA HÍBRIDA. A presente invenção refere-se a uma estufa híbrida que
compreende uma base para instalar a estufa híbrida em uma superfície, uma
armação espacial que delimita as faces laterais e uma face de topo para
encerrar um espaço acima da superfície, pelo menos uma tela transparente
retrátil para pelo menos parcialmente proteger o espaço dos elementos, quando
estendida, e uma rede para impedir a entrada de insetos no espaço enquanto
permite que o ar flua através da mesma. A armação espacial é fixada na base.
A tela transparente retrátil é retratilmente montada na armação espacial. A rede
é montada na armação espacial para encerrar o espaço por completo. Pelo
menos uma tela transparente retrátil é montada entre a rede removível e o
espaço.
(71) Les Industries Harnois Inc. (CA)
(72) Patrice Harnois, Yves Dube, Marc Coutu
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT CA2007/000353 de 05/03/2007
(87) WO 2007/101336 de 13/09/2007
(21) PI 0708667-9 A2 (22) 07/03/2007
1.3
(30) 08/03/2006 JP 2006-062564
(51) C23C 22/34 (2006.01), C09D 5/02 (2006.01), C09D 5/08 (2006.01), C09D
183/04 (2006.01), C09D 183/08 (2006.01), C23C 22/44 (2006.01), C23C 22/78
(2006.01)
(54) AGENTE DE TRATAMENTO DE SUPERFÍCIE DE METAL
(57) AGENTE DE TRATAMENTO DE SUPERFÍCIE DE METAL. A presente
invenção é um agente de tratamento de superfície para metal, contendo (a) um
composto de flúor de pelo menos um metal se- lecionado de Zr, Ti e Hf em uma
quantidade de 1 a 5.000 ppm em massa em termos de íon metálico, (b) um íon
de Cr trivalente em uma quantidade de 1 a 5.000 ppm em massa, (c) pelo
menos um íon metálico selecionado de Fe, Co, Zn, Mn, Mg, Ca, Sr, Aí, Sn, Ce,
Mo, W, Nb, Y e La em uma quantidade de 1 a 5.000 ppm em massa, e (d) um
composto apresentando pelo menos um grupo amidino em uma molécula em
uma quantidade de 1 a 10.000 ppm em massa, e sendo um líquido aquoso que
apresenta pH de 2,5 a 6, e proporciona um agente de tratamento de superfície
capaz de formar uma película tratada na superfície que apresenta tanto alta
propriedade de resistência à corrosão temporária quanto propriedade de
adesão a revestimento sobre uma superfície de um membro de alumínio de
fundição em molde, sem inclusão de cromo hexavalente que apresenta forte
toxicidade, o qual foi convencionalmente utilizado.
(71) Nippon Paint CO., LTD (JP)
(72) Aki Hashimoto, Mitsuhiro Yasuda, Toshiaki Shimakura
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT JP2007/054476 de 07/03/2007
(87) WO 2007/102557 de 13/09/2007
(21) PI 0708668-7 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 JP 2006-062452
(51) C07C 209/50 (2006.01), B01J 23/78 (2006.01), B01J 29/072 (2006.01),
B01J 29/076 (2006.01), C07C 211/03 (2006.01), C07C 291/04 (2006.01), C07B
61/00 (2006.01)
(54) MÉTODO PARA PRODUÇÃO DE COMPOSTO CONTENDO
NITROGÊNIO
RPI 2109 de 07/06/2011
(57) MÉTODO PARA PRODUÇÃO DE COMPOSTO CONTENDO
NITROGÊNIO. A presente invenção refere-se a um processo para produção de
aminas terciárias alifáticas de alta pureza contendo uma quantidade menor de
subprodutos, submetendo-se amidas de ácido alifáticas à redução por
hidrogenação em condições moderadas, bem como um processo para
produção de derivados de amina a partir de aminas terciárias alifáticas, com
boa produtividade, de maneira economicamente vantajosa. A presente invenção
refere-se a um processo para produção de uma amina terciária alifática
submetendo-se uma amida alifática específica à redução por hidrogenação na
presença de um catalisador contendo cobre e pelo menos um elemento
selecionado no grupo que consiste em elementos pertencentes aos grupos 2, 3
e 7 da Tabela Perlódica; o catalisador; e um processo para produção de óxido
de amina por reação da amida terciária obtida pelo processo de produção
acima com peróxido de hidrogênio.
(71) Kao Corporation (JP)
(72) Masaharo Jono, Michio Terasaka, Hideki Taniguchi, Tetsuaki Fukushima
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT JP2007/054504 de 08/03/2007
(87) WO 2007/102568 de 13/09/2007
(21) PI 0708669-5 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/780,907
(51) C07D 493/06 (2006.01)
(54) PROCESSO PARA PRODUÇÃO DE ÁLCOOIS DE ANIDROAÇÚCAR
(57) PROCESSO PARA PRODUÇÃO DE ÁLCOOIS DE ANIDROAÇÚCAR."
Um processo é fornecido para a preparação de álcoois de anidroaçúcar. O
processo envolve aquecer um álcool de açúcar ou um material de partida de
álcool de monoidroaçúcar na presença de um catalisador de ácido e sob
pressão. Opcionalmente o produto resultante é purificado. Purezas muito altas
são obtidas, sem necessitar o uso de solventes orgânicos no processo.
(71) Archer-Daniels-Midland Company (US)
(72) Alexandra J. Sanborn
(74) Nellie Anne Daniel-Shores
(85) 08/09/2008
(86) PCT US2007/006185 de 09/03/2007
(87) WO 2007/103586 de 13/09/2007
(21) PI 0708670-9 A2 (22) 06/03/2007
1.3
(30) 07/03/2006 US 60/780.027
(51) A61B 17/56 (2006.01)
(54) PLACA ORTOPÉDICA
(57) PLACA ORTOPÉDICA. Uma placa ortopédica tem uma parte com uma
superfície inferior curvada que é projetada para se estender longitudinalmente
ao longo do osso e muda a curva inferior à medida que ela avança de forma
proximal ao longo do osso a partir de um raio superficial a um raio mais agudo,
e adicionalmente espirala para baixo à medida que a placa avança. A placa
inclui um conjunto de abas, deslocadas do eixo longitudinal da placa para
fornecer melhores valores de desprendimento. As orelhas podem estar
localizadas na parte terminal da placa ou um pouco mais intermediárias ao
término da placa, dependendo da aplicação pretendida. Um ponto no centro do
furo de parafuso central pode ser usado para definir a origem da placa, e os
ângulos dos furos de parafusos e/ou pinos podem ser referenciados com
coordenadas X, Y, e Z em relação a esse furo central.
(71) Orthohelix Surgical Designs, Inc. (US)
(72) Lee A. Strnad, David B. Kay, Amanda Martin, G. Martin Wynkoop
(74) Nellie Anne Daniel Shores
(85) 08/09/2008
(86) PCT US2007/005624 de 06/03/2007
(87) WO 2007/103333 de 13/09/2007
(21) PI 0708671-7 A2 (22) 22/02/2007
1.3
(30) 06/03/2006 US 60/779.636
(51) A61K 31/195 (2006.01), A61K 31/197 (2006.01), A61P 25/20 (2006.01)
(54) LIGANTES ALFA-2-DELTA PARA SONO NÃO RESTAURADOR
(57) LIGANTES ALFA-2-DELTA PARA SONO NÃO RESTAURADOR. O uso de
um ligante alfa-2-delta ou seu sal farmaceuticamente aceitável para o
tratamento do sono não restaurador é relatado.
(71) Pfizer Products INC. (US)
(72) Timothy James Griffin, Bruce Gerald McCarthy, David Young Mitchell,
Daniele Marie-Claude Ouellet, Theresa Papa Stern, John Werth Jr.
(74) Nellie Anne Daniel Shores
(85) 08/09/2008
(86) PCT IB2007/000458 de 22/02/2007
(87) WO 2007/102058 de 13/09/2007
RPI 2109 de 07/06/2011
(21) PI 0708673-3 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/779,460; 20/10/2006 US 60/853,005
(51) C12P 17/00 (2006.01), C07D 209/20 (2006.01), C12N 9/88 (2006.01),
A23L 1/22 (2006.01)
(54) MÉTODO PARA FABRICAÇÃO DE POLIPEPTÍDEOS COM ATIVIDADE
DE ALDOLASE E POLINUCLEOTÍDEOS QUE CODIFICAM ESTES
POLIPEPTÍDEOS
(57) MÉTODO PARA FABRICAÇÃO DE POLIPEPTIDEOS COM ATIVIDADE
DE ALDOLASE E POLINUCLEOTÍDEOS QUE CODIFICAM ESTES
POLIPEPTÍDEOS. Esta invenção refere-se aos polipeptídeos tendo atividade
de aldolase, incluindo atividade de piruvato tal como, sem limitação, atividade
de aldolase de HMG e/ou KHG, polinucleotídeos codificando estes
polipeptídeos, e os métodos de preparar e empregar estes polinucleotídeos e
polipeptídeos. Em algumas modalidades, a invenção é direcionada aos
polipeptídeos tendo atividade de aldolase, incluindo atividade de piruvato tal
como, sem limitação, atividade de aldolase de HMG e/ou KHG, incluindo
atividade termoestável e termotolerante, e polinucleotídeos codificando estas
enzimas, e preparar e empregar estes polinucleotídeos e polipeptídeos. Os
polipeptídeos de acordo com a invenção podem ser empregados em uma
variedade de contextos industriais, farmacêuticos e agrícolas. Em algumas
modalidades, a invenção fornece polipeptídeos e trilhas biossintéticas que são
úteis na produção de ácido R-2-hid róxi 2-(indol-3-ilmetil)-4-cetoglutárico (R-MP)
e certos estereoisômeros de monatina, tais como R,R e S,R monatina, e sais
destes, bem como certos estereoisômeros de derivados de monatina, tais como
as configurações R3R e S5R, e sais destes.
(71) Cargill Incorporated (US)
(72) Ellen Burke, Steven John Gort, Paula M. Hicks, Peter Luginbuhl, Sara C.
McFarlan, Toby Richardson, Christopher Solheid, Davi Weiner, Lishan Zhao
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005718 de 07/03/2007
(87) WO 2007/103389 de 13/09/2007
(21) PI 0708674-1 A2 (22) 15/02/2007
1.3
(30) 11/03/2006 DE 10 2006 011 404.3
(51) B60K 23/02 (2006.01), F16D 23/12 (2006.01)
(54) DISPOSIÇÃO PARA A SOLICITAÇÃO POR PRESSÃO DE SISTEMA
HIDRÁULICO
(57) DISPOSIÇÃO PARA A SOLICITAÇÃO POR PRESSÃO DE SISTEMA
HIDRÁULICO. A presente invenção refere-se a uma disposição para a
solicitação por pressão de um sistema hidráulico, especialmente um sistema
hidráulico para o acionamento de uma embreagem no veio de acionamento de
um veículo automóvel, compreendendo um meio de acionamento (10), que está
ligado mecanicamente com um cilindro-mestre hidráulico (2), sendo que o
cilindro-mestre hidráulico (2) compreende pelo menos duas unidades de
produção de pressão (3, 4), as quais são ligadas com a mesma saída hidráulica
(19), da unidade de produção de pressão hidráulica (2).
(71) Luk Lamellen und Kupplungsbau Beteiligungs KG (DE)
(72) Dominik Hans
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT DE2007/000290 de 15/02/2007
(87) WO 2007/104277 de 20/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 79
(21) PI 0708675-0 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 US 60/780,125
(51) A61K 8/37 (2006.01), A61Q 19/00 (2006.01), A61Q 1/04 (2006.01), A61Q
1/06 (2006.01), A23P 1/08 (2006.01), C08K 5/00 (2006.01), C08K 5/11
(2006.01), C09D 5/08 (2006.01), C09J 191/00 (2006.01), C11C 3/00 (2006.01),
C07C 69/34 (2006.01), C07C 69/52 (2006.01), C07C 69/593 (2006.01)
(54) COMPOSIÇÕES COMPREENDENDO POLIOL ÉSTERES INSATURADOS
QUE SOFRERAM METÁTESE
(57) COMPOSIÇÕES COMPREENDENDO POLIOL ÉSTERES INSATURADOS
QUE SOFRERAM METÁTESE. A presente invenção refere-se a composições
similares a petróleo que compreendem poliol ésteres insaturados que sofreram
metátese. Também descritas são emulsões compreendendo poliol ésteres
insaturados que sofreram metátase. As composições similares a petrolato
podem ser usadas como substitutos para petrolato baseado em petróleo. As
emulsões podem ser emulsões água-em-óleo e óleo-em-água e podem ser
adequadas para uma variedade de usos finais.
(71) Elevance Renewable Sciences, Inc (US)
(72) Diza Pearl Braksmayer, Timothy A. Murphy, Stephen E. Russell, Michael
John Tupy, Scott A. Walters
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT US2007/005736 de 07/03/2007
(87) WO 2007/103398 de 13/09/2007
(21) PI 0708680-6 A2 (22) 07/03/2007
1.3
(30) 09/03/2006 EP 06110914.6
(51) C12P 13/08 (2006.01), C12P 13/00 (2006.01), C12N 15/63 (2006.01),
C12N 15/77 (2006.01)
(54) PROCESSO PARA PRODUÇÃO DE BETA-LISINA, PARA A PRODUÇÃO
DE BETA-AMINO-EPSILON-CAPROLACTAMA, PARA A PRODUÇÃO DE
EPSILON-CAPROLACTAMA, E PARA A PRODUÇÃO DE ÁCIDO EPSILONAMINO-CAPRÓICO
(57) PROCESSOS PARA A PRODUÇÃO DE BETA-USINA, PARA A
PRODUÇÃO DE BETA-AMJNO-EPSILON-CAPROLACTAMA, PARA A
PRODUÇÃO DE EPSILON-CAPROLACTAMA, E PARA A PRODUÇÃO DE
ÁCIDO EPSILON-AMINO-CAPRÓICO. Processo para a produção de 13-usina
por meio da construção de um microorganismo recombinante que possui um
gene de lisina-2,3-amino-mutase desregulado e pelo menos um gene
desregulado selecionado do grupo de (i) que consiste de aspartocinase,
asparto-semialdeido-desidrogenase,
di-hidro-dipicolinato-sintase,
di-hidrodipicolinato-redutase, tetra-hidro-dipicolinato-succinilase, succinil-amino-cetopimelato transaminase, succinil-diamino-pimelato-dessuccinilase, diaminopimelato-epimerase, diamino-pimelato-desidrogenase, arginil-tRNA-sintetase,
diamino-pimelato-descarboxilase,
piruvato-carboxilase,
fosfoenol-piruvatocarboxilase, glicose-6-fosfato-desidrogenase, transcetolase, transaldolase, 6fosfo-glicono-lactonase, frutose-1,6-bisfosfatase, homo-serina-desidrogenase,
80
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
fosfoenol-piruvato-carbóxi-cinase, succinil-CoA-sintetase, metil-malonil-CoAmutase, desde que se aspartocinase estiver desregulada como gene (i) pelo
menos um segundo gene (i) diferente de aspartocinase terá que estar
desregulado, e do cultivo de citado microorganismo.
(71) Basf SE (DE)
(72) Oskar Zelder, Weol Kyu Jeong, Corinna Klopprogge, Andrea Herold,
Hartwig Schröder
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT EP2007/052138 de 07/03/2007
(87) WO WO2007/101867 de 13/09/2007
(21) PI 0708681-4 A2 (22) 01/02/2007
1.3
(30) 02/02/2006 US 60/764.455
(51) H04N 7/16 (2011.01)
(54) CANAL DE VÍDEO MATRICIAL INTERATIVO E SISTEMAS PARA
DISTRIBUIR E EXIBIR O MESMO
(57) CANAL DE VÍDEO MATRICIAL INTERATIVO E SISTEMAS PARA
DISTRIBUIR E EXIBIR O MESMO. A presente invenção refere-se a um canal
de vídeo matricial interativo apresentado em um monitor, com uma pluralidade
de alimentações de video individuais sendo apresentada em um dado
momento. Um canal de vídeo matricial interativo de acordo com a presente
invenção compreende uma pluralidade de células de video apresentando pelo
menos informação, cada célula de video associada com uma dentre a
pluralidade de alimentações de video individuais, uma caixa de texto, e uma
barra de controle; em que um comando exibido na barra de controle seleciona
uma tela para exibição no monitor, a tela compreendendo informação
relacionada a pelo menos uma das células de vídeo associadas com uma
dentre a pluralidade de alimentações de vídeo individuais.
(71) The Directv Group, Inc. (US)
(72) David E. Shanks, Jon Dean, David E. Feldstein, Richard F. Purpura,
Matthew J. Thompson, Mark A. Shurgot, Craig Le
(74) Bhering Advogados
(85) 04/08/2008
(86) PCT US2007/002765 de 01/02/2007
(87) WO WO2007/092251 de 16/08/2007
(21) PI 0708682-2 A2 (22) 01/02/2007
1.3
(30) 02/02/2006 US 60/764.460
(51) A01B 71/08 (2006.01)
(54) CANAL DE VÍDEO MATRICIAL INTERATIVO E SISTEMAS PARA
DISTRIBUIR E EXIBIR O MESMO
(57) CANAL DE VÍDEO MATRICIAL INTERATIVO E SISTEMAS PARA
DISTRIBUIR E EXIBIR O MESMO. A presente invenção refere-se a um canal
de vídeo matricial interativo apresentado em um monitor, com uma pluralidade
de alimentações de vídeo individuais sendo apresentadas em um dado
momento. Um canal de vídeo matricial interativo de acordo com a presente
invenção compreende uma pluralidade de células de vídeo apresentando pelo
menos informação, cada célula de vídeo associada com uma dentre a
pluralidade de alimentações de video e a caixa de texto, em que dados
estatistícos são exibidos com pelo menos um grupo compreendendo a
pluralidade de células de vídeo e a caixa de texto, os dados estatísticos
gerados de fora do canal de vídeo matricial interativo.
(71) The Directv Group, Inc. (US)
(72) David E. Shanks, David E. Feldstein, Richard F. Purpura Purpura, Matthew
J. Thompson, Mark A. Shurgot, Craig Le
(74) Bhering Advogados
(85) 04/08/2008
(86) PCT US2007/002870 de 01/02/2007
(87) WO WO2007/092300 de 16/08/2007
(21) PI 0708683-0 A2 (22) 27/02/2007
1.3
(51) E02D 29/02 (2006.01)
(54) ESTRUTURA DE SOLO ESTABILIZADA E ELEMENTOS DE
REVESTIMENTO PARA SUA CONSTRUÇÃO
(57) ESTRUTURA DE SOLO ESTABILIZADA E ELEMENTOS DE
REVESTIMENTO PARA SUA CONSTRUÇÃO. O elemento de revestimento
para uma estrutura de solo estabilizada compreende um corpo de material
fundido dentro do qual uma trajetória é formada para uma tira de reforço entre
dois pontos de surgimento situados em uma face traseira do elemento. Essa
trajetória é definida por um forro embutido no material fundido e inclui duas
partes retilíneas que são respectivamente adjacentes aos dois pontos de
surgimento e são, cada uma, dispostas de forma a posicionar a tira no mesmo
plano de surgimento perpendicular â face traseira, duas partes curvas que
continuam respectivamente as duas partes retilíneas e são dispostas de modo a
desviar a tira do plano de surgimento, e uma parte de conexão que une as duas
partes curvas uma a outra e tem pelo menos um anel situado fora do plano de
surgimento.
(71) Terre Armee Internationale S.A.S. (FR)
(72) Nicolas Freitag, Jean-Claude Morizot
(74) Montaury, Pimenta, Machado & Lioce S/C Ltda
(85) 08/09/2008
(86) PCT IB2007/000525 de 27/02/2007
(87) WO 2007/102070 de 13/09/2007
(21) PI 0708684-9 A2 (22) 05/03/2007
1.3
(30) 07/03/2006 DE 10 2006 010 828
(51) H01H 57/00 (2006.01), H01H 3/32 (2006.01)
(54) ELEMENTO DE INTERRUPTOR ELÉTRICO, PARTICULARMENTE UM
RELÉ, COM MECANISMO DE INTERRUPTOR DE ALAVANCA GIRATÓRIA
(57) ELEMENTO DE INTERRUPTOR ELÉTRICO, PARTICULARMENTE UM
RELE, COM MECANISMO DE INTERRUPTOR DE ALAVANCA GIRATÓRIA.
Um elemento de interruptor elétrico, particularmente um relé, é fornecido com
um atuador (5) com um contato de interruptor (2) e um mecanismo de
interruptor (7). O mecanismo de interruptor traduz um movimento de
RPI 2109 de 07/06/2011
acionamento (6) do atuador em um movimento de comutação (4) do contato de
interruptor de forma que o contato de interruptor é colocado e não colocado em
contato com um contato de junção (3). Para criar um movimento de comutação
com um levantamento grande no caso de um atuador que pode apenas
executar um movimento de acionamento com levantamento pequeno, o
mecanismo de interruptor tem duas alavancas giratórias (8) conectadas uma à
outra por meio do atuador e pelo menos um retentor de contato (10). O retentor
de contato conecta as duas alavancas giratórias em sua direção longitudinal
(15) e é configurado assim para poder ser desviado transversal para sua
direção longitudinal.
(71) Tyco Electronics AMP Gmbh (DE)
(72) Heinz-Michael Ehrlich
(74) Nellie Anne Daniel Shores
(85) 08/09/2008
(86) PCT EP2007/001862 de 05/03/2007
(87) WO WO2007/101638 de 13/09/2007
(21) PI 0708685-7 A2 (22) 06/03/2007
1.3
(30) 06/03/2006 JP 2006-060277; 06/03/2006 JP 2006-060298
(51) C07C 65/24 (2006.01), C07C 51/353 (2006.01), C07C 67/32 (2006.01),
C07C 67/343 (2006.01), C07C 69/738 (2006.01), C07C 69/92 (2006.01), C07C
69/94 (2006.01), C07C 229/34 (2006.01), C07D 215/56 (2006.01)
(54) MÉTODO PARA PRODUZIR COMPOSTO DE 4-OXOQUINOLINA
(57) MÉTODO PARA PRODUZIR COMPOSTO DE 4-OXOQUINOLINA. A
presente invenção refere-se a um composto útil como um intermediário sintético
para um agente anti-HIV que tem uma atividade inibidora de integrase, e um
método de produção deste, e um método de produção de um agente anti-HIV
utilizando-se o intermediário sintético. Especificamente, por exemplo, um
composto representado pela fórmula (2'): em que R é um átomo de flúor ou um
grupo metóxi, e R400 é um átomo de hidrogênio ou um grupo C1 -04 alquila, ou
um sal deste, e um método de produção deste, e um método de produção de
um agente anti-HIV utilizando-se o intermediário sintético.
(71) Japan Tobacco INC (JP)
(72) Takahiro Yamasaki, Jun-Ichi Hoshi, Shigeji Ohki, Koji Ando, Koji Matsuda
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT JP2007/054348 de 06/03/2007
(87) WO WO2007/102512 de 13/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 81
e o outro é disposto e projetado para fixação de um segundo lado longitudinal
do elemento metálico no lugar, o dito segundo lado longitudinal sendo oposto
ao primeiro lado longitudinal do elemento metálico. As seções de fixação são
fornecidas, cada uma, em uma unidade de suporte (15, 35, 36, 39, 40), por
meio das quais as seções de fixação, durante o movimento de avanço do
elemento metálico, são automaticamente espaçadas essencialmente de forma
perpendicular à direção do movimento do elemento metálico.
(71) Protektorwerk Florenz Maisch Gmbh & Co. KG (DE)
(72) Heiner Willerscheid, Mario Gasperini, Bernd Spissinger, Kilian Krettenauer
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001734 de 28/02/2007
(87) WO WO2007/101594 de 13/09/2007
(21) PI 0708687-3 A2 (22) 01/03/2007
1.3
(30) 08/03/2006 EP 06 004693.5
(51) C12N 15/15 (2006.01), C07K 14/81 (2006.01), C12N 1/19 (2006.01), A61K
38/57 (2006.01)
(54) DOMÍNIOS DE KUNITZ QUIMÉRICOS E SEU USO
(57) DOMÍNIOS DE KUNITZ QUIMÉRICOS E SEU USO. A presente invenção
refere-se a quimeras de domínio 1 de inibidor de fator de tecido humano com
domínios de Kunitz naturais e não naturais, e sua preparação e aplicação.
(71) Bayer Healthcare AG (DE)
(72) Felix Oehme, Heiner Apeler, Frank Dittmer, Juergen Franz, Axel Harrenga,
Michael Sperzel, Simone Greven, Juergen Lenz
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001753 de 01/03/2007
(87) WO WO2007/101602 de 13/09/2007
(21) PI 0708688-1 A2 (22) 08/03/2007
1.3
(30) 08/03/2006 DE 10 2006 010775.6
(51) D03D 1/00 (2006.01), D03D 47/02 (2006.01)
(54) WEBBING DE CINTO DE SEGURANÇA, MÉTODO E AGULHA ESTREITA
DE TECIDO DE TECELAGEM PARA PRODUÇÃO DO MESMO
(57) WEBBING DE CINTO DE SEGURANÇA, MÉTODO E AGULHA ESTREITA
DE TECIDO DE TECELAGEM PARA PRODUÇÃO DO MESMO. A invenção
refere-se a um método de tecelagem de uma lona trançada (lado direito),
compreendendo de pelo menos um primeiro fio de trama (SFR) e pelo menos
um segundo fio de trama (lado esquerdo), caracterizado pelo fato de que os
dois fios de trama (SFL, SFR) são introduzidos no mesmo abrigo de ambos os
lados da lona trançada, enrolados em torno dos retentores de fios de trama em
palhetas após a mudança de abrigo e são ligadas contra a parada.
(71) Johann Berger (DE)
(72) Johann Berger
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/002021 de 08/03/2007
(87) WO WO2007/101692 de 13/09/2007
(21) PI 0708686-5 A2 (22) 28/02/2007
1.3
(30) 08/03/2006 DE 10 2006 010 795.0
(51) B21D 31/04 (2006.01)
(54) DISPOSITIVO E MÉTODO PARA ALARGAMENTO DE ELEMENTOS
METÁLICOS
(57) DISPOSITIVO E MÉTODO PARA ALARGAMENTO DE ELEMENTOS
METÁLICOS. A presente invenção refere-se a um dispositivo e um método para
alargar elementos metálicos alongados (11, 65) que movem na direção
longitudinal e são planos pelo menos em determinadas regiões são descritos. O
dispositivo compreende pelo menos duas seções de fixação (19, 38, 49, 50)
que são opostas uma à outra e das quais uma é disposta e projetada para
fixação de um primeiro lado longitudinal (22, 67) do elemento metálico no lugar
82
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(71) Boehringer Ingelheim International GMBH (DE)
(72) Achim Moser, Klaus Kadel
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001558 de 23/02/2007
(87) WO WO2007/101557 de 13/09/2007
(21) PI 0708689-0 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 EP 06 110805.6
(51) A61K 35/74 (2006.01), A23L 1/29 (2006.01), A23L 1/30 (2006.01), A23C
21/02 (2006.01)
(54) MISTURA SIMBIÓTICA
(57) MISTURA SIMBIÓTICA. A invenção refere-se a uma preparação que
compreende uma cepa bacteriana probiótica e uma mistura prebiótica
compreendendo 5-70% em peso de pelo menos um oligossacarídeo N-acetilado
selecionado
do
grupo
compreendendo
GalNAcl,3Galß,4Glc
e
Galß1,6GalNAc1,3Galß1,4Glc, 20-95% em peso de pelo menos um
oligossacarídeo neutro selecionado do grupo compreendendo Galß1,6Gal,
Galß1,6Galß1,4Glc Galß1,6Galß1,6Glc, Galß1,3GalßGlc, Galß1,3Galß1,4Glc,
Galß 1,6Galß 1,6Galß 1,4GIc Galß 1,6Galß 1,3Galß 1,4GIc Galß 1,6Galß
1,4GIc e Galß1,3Galß1,3Galß1,4Glc e 2,50% em peso de pelo menos um
oligossacarídeo
sialilado
selecionado
do
grupo
compreendendo
NeuAc2,3Galß1,4Glc e NeuAc2,5Galß1,4Glc. A invenção se estende a
produtos alimentícios que compreendem essa preparação ao uso da
preparação na prevenção e tratamento de infecções.
(71) Nestec S.A. (CH)
(72) Norbert Sprenger, François Morgan, Rafael Berrocal, Marcel Braun,
Christine Cherbut, Peter Duncan
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001961 de 07/03/2007
(87) WO WO2007/101675 de 13/09/2007
(21) PI 0708690-3 A2 (22) 23/02/2007
1.3
(30) 07/03/2006 DE 10 2006 010 877.9; 23/11/2006 DE 10 2006 055 661.5
(51) B05B 1/34 (2006.01), F02M 61/16 (2006.01)
(54) BOCAL DE TURBILHONAMENTO
(57) BOCAL DE TURBILHONAMENTO. A presente invenção refere-se a um
bocal de turbilhonamento tendo uma pluralidade de canais de entrada e um
canal de saída que se estende transversalmente ao mesmo, um uso do bocal
de turbilhonamento e métodos de produção de um bocal de turbilhonamento
são propostos. Uma construção compacta, simples e uma fácil fabricação são
possibilitadas em função do fato de que os canais de entrada se abrem
diretamente e/ou tangencialmente para dentro de canal de saída. De maneira
alternativa ou adicionalmente, a montante dos canais de entrada, é provida uma
estrutura de filtro tendo seções transversais de fluxo menores que as dos
canais interno. O bocal de turbilhonamento é usado, em particular, para a
atomização de uma formulação medicamentosa líquida, O bocal de
turbilhonamento é produzido a partir de dois componentes em forma de chapa,
o canal de saída sendo primeiramente gravado à água forte como um furo cego
em um componente e em seguida aberto por meio da moagem do componente.
De maneira alternativa ou adicionalmente, o canal de saída é feito de um
componente diferente dos canais de entrada.
(21) PI 0708691-1 A2 (22) 06/03/2007
1.3
(30) 06/03/2006 CN 200610054110.1
(51) A61K 9/70 (2006.01), A61K 47/30 (2006.01), A61K 31/135 (2006.01), A61P
25/00 (2006.01)
(54) EMPLASTRO TRANSDÉRMICO CONTENDO RASAGILINA PARA O
TRATAMENTO OU PROFILAXIA DE DOENÇA DO SISTEMA NERVOSO E
SEU PREPARO
(57) EMPLASTRO TRANSDÉRMICO CONTENDO RASAGILINA PARA O
TRATAMENTO OU PROFILAXIA DE DOENÇA DO SISTEMA NERVOSO E
SEU PREPARO. A presente invenção refere-se a um emplastro transdérmico
de rasagilina para o tratamento ou profilaxia de doenças do sistema nervoso, no
qual o emplastro compreende uma camada de revestimento inerte
quimicamente inerte aos ingredientes do substrato, uma camada de substrato
compreendendo rasagilina ou um sal farmaceuticamente aceitável da mesma e
uma camada protetora a ser descamada antes de uso. A camada de substrato
é um sistema adesivo compreendendo um material polimérico orgânico como
base e um material inorgânico ou orgânico como enchedor e uma pluralidade
de microrreservatórios contendo rasagilina. O substrato ainda compreende uma
ou mais substâncias para intensificação da absorção transdérmica de
rasagilina, no qual o material polimérico orgânico acima no substrato é usado
para o reservatório de rasagilina e como adesivo.
(71) Chongqing Pharmaceutical Research Institute Co., Ltd. (CN) ,
Shanghaifosun Pharmaceutical (Group) Co., Ltd. (CN)
(72) Jialiang Lin, Jinmai Xiao, Jie Deng
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT CN2007/000713 de 06/03/2007
(87) WO WO2007/101400 de 13/09/2007
(21) PI 0708694-6 A2 (22) 07/03/2007
1.3
(30) 07/03/2006 EP 06 004640.6
(51) C12N 9/26 (2006.01), C12N 15/82 (2006.01)
(54) MÉTODOS PARA AUMENTAR A PROPORÇÃO DE BROTO PARA RAIZ,
A PRODUÇÃO DE SEMENTES E A RESISTÊNCIA A DOENÇAS
(57) MÉTODOS PARA AUMENTAR A PROPORÇÃO DE BROTO PARA RAIZ,
A PRODUÇÃO DE SEMENTES E A RESISTÊNCIA A DOENÇAS. A presente
invenção refere-se a um método para aumentar a proporção de broto para raiz
de uma planta compreendendo a etapa de inibir a atividade de uma invertase
no tecido da raiz da referida planta.
(71) Julius-Maximilians-Universität Würzburg (DE)
(72) Thomas Roitsch, Maria de La Cruz Gonzalez Garcia
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 08/09/2008
(86) PCT EP2007/001964 de 07/03/2007
(87) WO 2007/101678 de 13/09/2007
RPI 2109 de 07/06/2011
(21) PI 0708695-4 A2 (22) 06/03/2007
1.3
(30) 08/03/2006 US 60/780099; 10/07/2006 US 11/483791
(51) E04C 3/02 (2006.01), E04C 2/34 (2006.01)
(54) ESTRUTURA DE PAREDE CLASSIFICADA PARA INCÊNDIO
(57) ESTRUTURA DE PAREDE CLASSIFICADA PARA INCÊNDIO. Uma
estrutura de parede classificada para incêndio inclui uma trilha de topo e trilha
de fundo em forma de canal, cada uma tendo saliências machos formadas ao
longo das suas paredes laterais. A estrutura de parede ademais inclui pelo
menos um membro de esteio interconectando as trilhas de topo e fundo. O
membro de esteio inclui uma porção estacionária e uma extensão corrediça
aninhada de modo deslizante dentro da porção estacionária. Rebaixos fêmeas
são formados em uma extremidade de término de cada uma da extensão
corrediça e porção estacionária e são adaptados para se aninhar com
saliências machos da trilhas de topo e fundo. Uma fenda formada dentro da
extensão corrediça acomoda prendedores iniciados de um membro de painel e
que passa pela parede lateral de porção estacionária e se estende na fenda
para permitir movimento corrediço relativo entre a extensão corrediça e o
membro de esteio. Uma sobretampa de topo disposta em relação sobreposta à
trilha de topo inclui uma saliência macho para contatar de modo deslizante
contra o membro de painel.
(71) Trakloc North America, Llc (US)
(72) William J. Andrews, Geoffrey Darmody, Albert S. Hill
(74) Momsen, Leonardos & CIA.
(85) 08/09/2008
(86) PCT US2007/005621 de 06/03/2007
(87) WO 2007/103331 de 13/09/2007
(21) PI 0708696-2 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/781.252; 08/03/2007 US 11/683.977
(51) G06Q 99/00 (2006.01)
(54) SISTEMA E MÉTODO DE INSTRUMENTAÇÃO DE PAGAMENTO
ELETRÔNICO
(57) SISTEMA E MÉTODO DE INSTRUMENTO DE PAGAMENTO
ELETRÔNICO. Um instrumento que poderá ser adquirido em local de varejo e
utilizado para conduzir transferências financeiras e outras transações
financeiras. A quantia associada ao instrumento é armazenada em uma conta
nào-bancária mantida por uma entidade de transferência de dinheiro. Para
ativar o instrumento após ele ter sido comprado, o cliente enlaça o instrumento
a um perfil pessoal do cliente utilizando um PIN fornecido com o instrumento.
(71) The Western Union Company (US)
(72) Kurt L. Hansen, Wade Nelson, Dean A. Seifert, Assaad G. Hanna
(74) Orlando de Souza
(85) 09/09/2008
(86) PCT US2007/063732 de 09/03/2007
(87) WO 2007/104060 de 13/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 83
(21) PI 0708697-0 A2 (22) 23/02/2007
1.3
(30) 09/03/2006 DE 10 2003 010 842.6
(51) B01D 21/24 (2006.01), B01D 29/66 (2006.01)
(54) DISPOSITIVO E PROCESSO PARA TRATAMENTO DE FLUIDO LAVADO
EM CONTRACORRENTE
(57) DISPOSITIVO E PROCESSO PARA TRATAMENTO DE FLUIDO LAVADO
EM CONTRACORRENTE. A presente invenção refere-se a um dispositivo para
tratamento de fluido lavado em contracorrente de um filtro de lavagem em
contracorrente, que contenha sólidos, abrangendo um dispositivo de
sedimentação para separação de sólidos do fluido reciclado mediante
sedimentação em uma região de coleta de sedimento (178), que possibilite uma
descarga de sólido isenta de meios de filtragem auxiliares, e apresente uma
perda de fluido tão pequena quanto possível, propõe-se que o dispositivo de
sedimentação abranja um dispositivo de eclusa (172), por meio do qual a região
de coleta de sedimento (178) durante uma fase de sedimentação possa ser
unida com um recipiente de sedimentação (140) e, durante uma fase de
descarga, possa ser separada do recipiente de sedimentação (140) e
esvaziada.
(71) Dürr Ecoclean GMBH (DE)
(72) Egon Käske
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT EP2007/001570 de 23/02/2007
(87) WO 2007/101561 de 13/09/2007
(21) PI 0708698-9 A2 (22) 23/02/2007
1.3
(30) 09/03/2006 DE 10 2006 010 843.4
(51) B01D 29/66 (2006.01), B01D 29/94 (2006.01)
(54) DISPOSITIVO DE FILTRO E PROCESSO DE FILTRAGEM
(57) DISPOSITIVO DE FILTRO E PROCESSO DE FILTRAGEM. A presente
invenção refere-se a um dispositivo de filtro para a filtragem de um meio fluido
contendo sólidos, abrangendo um filtro de lavagem em contracorrente (108) e
um conduto de lavagem (136), pelo qual durante uma fase de lavagem em
contracorrente, o fluido lavado em contracorrente pode ser aduzido do filtro de
lavagem em contracorrente a um dispositivo de tratamento ulterior, em que a
descarga de sujeira do filtro de lavagem em contracorrente seja facilitada, se
propõe que o filtro de lavagem em contracorrente apresente uma saída de
sujeira grossa, que está unida com o conduto de lavagem, de modo que a
84
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
sujeira grossa que chega ao conduto de lavagem pela saída de sujeira grossa
pode ser aduzida, durante a fase de lavagem em contracorrente, juntamente
com o fluido lavado em contracorrente, ao dispositivo de tratamento ulterior.
(71) Dürr Ecoclean GMBH (DE)
(72) Egon Käske
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT EP2007/001571 de 23/02/2007
(87) WO 2007/101562 de 13/09/2007
(21) PI 0708699-7 A2 (22) 27/11/2007
1.3
(30) 07/12/2006 DE 10 2006 058 044.3
(51) C03B 7/098 (2006.01), C03B 5/26 (2006.01)
(54) PROCESSO E DISPOSITIVO PARA EXTRAÇÃO DE MASSA FUNDIDA
DE VIDRO DE CANAIS DE ESCOAMENTO
(57) PROCESSO E DISPOSITIVO PARA EXTRAÇÃO DE MASSA FUNDIDA
DE VIDRO DE CANAIS DE ESCOAMENTO. A presente invenção refere-se a
um processo e a um dispositivo para extração de massa fundida de vidro (3) de
canais de escoamento (1), que são guiados para o transporte de vidro de
produção de um forno de fusão a um ponto de retirada (8) para o vidro de
produção, sendo que o canal de escoamento (1) apresenta uma guarnição
interna (5a) resistente a vidro e sendo que ao ponto de retirada para o vidro de
produção está pré-conectado um dispositivo de drenagem (20) para vidro de
fundo. Para se poder retirar então eletros de aquecimento (22) da massa
fundida de vidro (3) e, não obstante, exercer influência local e temporal sobre o
perfil de temperatura dentro da seção transversal de fluxo se propõe, de acordo
com a invenção, que a) a guarnição interna (5a) consista, ao menos na região
do dispositivo de drenagem (20), em um material mineral do grupo dos
compostos AZS e ZAC eletricamente condutor, fundido, e possua uma abertura
de drenagem (23) para o vidro de fundo e acima da mesma uma fenda de
drenagem (21), e que b) ao menos dois eletrodos (22) estejam dispostos em
lados mutuamente contrapostos do canal de escoamento (1) e do dispositivo de
drenagem, os quais são executados em forma de barra e com suas áreas
frontais (22a) tão introduzidos na guarnição interna (5a) em direção à massa
fundida de vidro (3) e sem contato com a massa fundida de vidro que a parte
predominante dos fluxos de corrente é guiada pela massa fundida de vidro (3) e
atinge uma placa de eletrodo (24), que fica disposta abaixo da abertura de
drenagem (23).
(71) Beteiligungen Sorg GMBH & CO. KG (DE)
(72) Jürgen Grössler
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT EP2007/010264 de 27/11/2007
(87) WO 2008/067929 de 12/06/2008
(21) PI 0708700-4 A2 (22) 26/02/2007
1.3
(30) 09/03/2006 DE 10 2006 010 941.4
(51) A01N 43/80 (2006.01), A01N 37/34 (2006.01)
(54) COMPOSIÇÕES BIOCIDAS CONTENDO 1,2-BENZISOTIAZOLIN-3-ONA
E 1,2-DIBROMO-2,4-DI-CIANOBUTANO
(57) COMPOSIÇÕES BIOCIDAS CONTENDO 1,2-BENZISOTIAZOLIN-3-ONA
E 1 ,2-DIBROMO-2,4-DI-CIANOBUTANO. A presente invenção refere-se às
composições bioçidicas na forma de soluções, contendo a) 1,2-benzisotiazolin3-ona (fórmula (I)) e/ou um sal do mesmo, preferivelmente o sal alcalino ou de
amônio do mesmo, em particular um sal de lítio, sódio ou potássio; b) 1 ,2dibromo-2,4-dicianobutano (fórmula (II)); e) pelo menos um solvente da fórmula
(III) R1 - (O-A)(X+y) - O-R2 (III) em que e R2 são cada qual independentemente
hidrogênio ou um grupo alquila saturado ou insaturado, linear ou ramificado
com 1 a 8 átomos de carbono, (O-A) é um grupo alcóxi selecionado de um
grupo elilenóxi (EO), um grupo propilenóxi (PO), um grupo butilenóxi e/ou um
grupo feniletóxi, x representa um número variando de 1 a 15 e y representa um
número variando de 0 a 10.
(71) Clariant International LTD (CH)
(72) Uwe Falk, Marcus Michael Walter
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT EP2007/001629 de 26/02/2007
(87) WO 2007/101576 de 13/09/2007
(21) PI 0708701-2 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 EP 06110973.2; 20/04/2006 EP 06112822.9
(51) A61K 35/74 (2006.01), A61P 11/00 (2006.01), A61P 37/00 (2006.01)
(54) USO DE UM SACARÍDEO NÃO DIGERÍVEL SOLÚVEL EM ÁGUA
(57) USO DE UM SACARIDEO NÃO DIGERIVEL SOLÚVEL EM ÁGUA. É
descrito um alimento ou suplemento para as mulheres grávidas que
compreende sacarídeos não digeríveis solúveis em água. A composição é
utilizada para melhorar a flora e/ou o sistema imune das mulheres grávidas,
para melhorar o sistema imune do bebê e para melhorar a flora intestinal do
bebê após o nascimento.
(71) N.V. Nutricia (NL)
(72) Christopher Beermann, Jan Knol, Martine Sandra Alles, Bernd Stahl,
Günther Boehm
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT NL2007/050094 de 09/03/2007
(87) WO 2007/105945 de 20/09/2007
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 85
(21) PI 0708702-0 A2 (22) 08/03/2007
1.3
(30) 10/03/2006 US 60/782,325
(51) B01D 53/62 (2006.01), B01J 10/00 (2006.01), C01F 11/02 (2006.01), C01F
11/18 (2006.01), C04B 2/00 (2006.01), C04B 7/00 (2006.01), C09K 3/00
(2006.01)
(54) MATERIAIS E PROCESSOS PARA SEQUESTRAÇÃO DE DIÓXIDO DE
CARBONO
(57) MATERIAIS E PROCESSOS PARA SEQUESTRAÇÃO DE DIÓXIDO DE
CARBONO. A presente invenção refere-se a métodos e sistemas para a
seqüestraçáo e/ou redução do dióxido de carbono presente em uma corrente
fluida de efluente industrial contendo dióxido de carbono. Um material de
lavagem compreendendo um primeiro componente, um segundo componente
(distinto do primeiro componente) e, de preferência, água é contactado com a
corrente fluida de efluente. O primeiro componente compreende uma fonte de
óxido de cálcio e uma fonte de lons de metais alcalinos. O segundo
componente compreende uma escória com um ou mais componentes de
silicato reativos. Também se apresenta métodos de redução do dióxido de
carbono da exaustão gerada por fontes de combustão, fornos de cal e/ou
cimento, fornos de ferro e/ou aço e outros. Também se apresentam sistemas de
redução das emissões de dióxido de carbono. Também se apresentam métodos
de reciclagem de subprodutos industriais.
(71) Douglas C. Comrie (US)
(72) Douglas C. Comrie
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT US2007/005976 de 08/03/2007
(87) WO 2007/106372 de 20/09/2007
(21) PI 0708703-9 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 EP 06110936.9
(51) C10L 1/08 (2006.01)
(54) COMPOSIÇÃO DE COMBUSTÍVEL, E, USO DA COMPOSIÇÃO DE
COMBUSTÍVEL
(57) COMPOSIÇÃO DE COMBUSTÍVEL, E, USO DA COMIPOSIÇÃO DE
COMBUSTÍVEL. Composição de combustível compreendendo uma mistura de
hidrocarbonetos tendo um número de cetano de pelo menos 62, uma
viscosidade cinemática a 400C maior do que 3,0 cSt e uma densidade a 15ºC
maior do que 830 kg/m3, em que (i) o valor da Cicatriz de Desgaste da
composição de combustível é abaixo de 350 mícrons, como determinado por
CEC-F-06-A-96 e/ou (ii) a composição de combustível compreende (b) um
combustível parafinico, ebulindo na faixa do gasóleo compreendendo mais do
que 90% em peso de parafinas e tendo um número de cetano entre 70 e 85, em
combinação com (a) um gasóleo derivado de mineral tendo uma densidade a
150C entre 800 e 860 kg/m3 e uma viscosidade cinética a 40ºC entre 1,5 e 15
cSt (mm2/s) e/ou (c) um componente de mistura rico em composto nafrénico,
ebulindo na faixa de gasóleo tendo uma densidade a 15ºC maior do que 860
kg/m3 e tendo um ponto de escoamento abaixo de - 30ºC.
(71) Shell Internationale research Maatschappij B.V. (NL)
(72) Jörg Landschof
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/052213 de 09/03/2007
(87) WO 2007/104709 de 20/09/2007
(21) PI 0708704-7 A2 (22) 15/03/2007
1.3
(30) 15/03/2007 US 11/686,945; 15/03/2008 US 60/783,196
(51) G01C 21/12 (2006.01)
(54) SISTEMA DE ORIENTAÇÃO BASEADO EM SENSOR
(57) SISTEMA DE ORIENTAÇÃO BASEADO EM SENSOR. Um método para
medir mudanças na posição de um objeto, incluindo rotação em torno de
qualquer um ou todos de três eixos, utilizando acelerômetros lineares. E
revelado um método de utilização de um acelerômetro linear para integrar dois
outros acelerômetros lineares 3D de modo a medir e abastecer para utilização
adicional informações de seis dimensões, isto é, transíação em três dimensões
e rotação em torno de três eixos. Dois sensores de acelerômetro linear são
utilizados para determinar todas com exceção de uma das variáveis nos seis
graus de liberdade. A saída de um terceiro acelerômetro gera a necessidade
dos dados de determinar um sexto grau de liberdade, rotacional. A necessidade
por um giroscópio para detectar mudanças em ângulo de guinada (i.e., guinada
ou azimute) pode, desse modo, ser evitada.
(71) Qualcomm Incorporated (US)
(72) Leonid Sheynblat
(74) Montaury Pimenta, Machado & Lioce
(85) 09/09/2008
(86) PCT US2007/064113 de 15/03/2007
(87) WO 2007/127537 de 08/11/2007
(21) PI 0708705-5 A2 (22) 09/03/2007
(30) 10/03/2006 EP 06004998.8
1.3
(51) A23K 1/165 (2006.01), C12N 9/96 (2006.01), C12N 9/98 (2006.01)
(54) FORMULAÇÃO ENZIMÁTICA SÓLIDA, PROCESSO PARA PRODUZIR A
MESMA, USO DE UMA FORMULAÇÃO ENZIMÁTICA SECA, E, RAÇÃO,
GÊNERO ALIMENTÍCIO OU SUPLEMENTO ALIMENTAR
(57) FORMULAÇÃO ENZIMATICA SÓLIDA, PROCESSO PARA PRODUZIR A
MESMA, USO DE UMA FORMULAÇÃO ENZIMATICA SECA, E, RAÇÃO,
GÊNERO ALIMENTÍCIO OU SUPLEMENTO ALIMENTAR. A presente invenção
diz respeito a novas formulações enzimáticas sólidas compreendendo misturas
de pelo menos uma composição enzimática estabilizada em sal, pelo menos um
suporte particulado e pelo menos um fluido hidrofóbico. A invenção, além disso,
diz respeito a processos para a preparação de tais formulações enzimáticas
sólidas, e a rações, gêneros alimentícios, e suplementos alimentares contendo
tais formulações enzimáticas.
(71) Basf Se (DE)
(72) Markus Lohscheidt, Roland Betz, Jörg Braun, Wolf Pelletier
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/052256 de 09/03/2007
(87) WO 2007/104725 de 20/09/2007
(21) PI 0708706-3 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 US 11/373412; 07/03/2007 US 11/683380; 07/03/2008 US
11/683338
(51) A23L 2/02 (2006.01), A23L 2/38 (2006.01), A23L 2/385 (2006.01), A23L
2/39 (2006.01), A23L 2/42 (2006.01), A23L 2/46 (2006.01), A23L 2/48
(2006.01), A23L 2/52 (2006.01), A23L 2/54 (2006.01)
(54) COMPOSIÇÃO DE BEBIDA DE PROTEÍNA, MÉTODO PARA PREPAR A
MESMA, COMPOSIÇÃO DE XAROPE CONCENTRADO DE BEBIDA DE
PROTEÍNA, COMPOSIÇÃO DE PÓ CONCENTRADO DE BEBIDA DE
PROTEÍNA, MÉTODOS PARA PREPARAR UMA COMPOSIÇÃO DE XAROPE
CONCENTRADO DE BEBIDA DE PROTEÍNA E PARA PREPARAR UMA
COMPOSIÇÃO DE PÓ CONCENTRADO DE BEBIDA DE PROTEÍNA, BEBIDA
DE PROTEÍNA, MÉTODO PARA PREPARAR A MESMA
(57) COMPOSIÇÃO DE BEBIDA DE PROTEINA, METODO PARA PREPARAR
A MESMA, COMPOSIÇÃO DE XAROPE CONCENTRADO DE BEBIDA DE
PROTEÍNA, COMPOSIÇÃO DE PÓ CONCENTRADO DE BEBIDA DE
PROTEINA, METODOS PARA PREPARAR UMA COMPOSIÇÃO DE XAROPE
CONCENTRADO DE BEBIDA DE PROTEINA E PARA PREPARAR UMA
COMPOSIÇÃO DE PÓ CONCENTRADO DE BEBIDA DE PROTEiNA, BEBIDA
DE PROTEINA, METODO PARA PREPARAR A MESMA. Uma bebida com
proteína aperfeiçoada que pode proporcionar teor relativamente elevado de
proteína, compreendendo de cerca de 0,01 % em peso a cerca de 15 % em
peso, ao mesmo tempo em que se emprega opcionalmente uma concentração
de carbonatação entre cerca de 0,1 volume de carbonatação (por volume de
líquido) a cerca de 6 volumes de carbonatação. De preferência, a proteína é
uma proteína como, de preferência, uma proteína de soro de leite, ou outras. A
bebida com proteína pode conter suco e/ou aditivo que proporciona incremento
de geração de energia. A bebida com proteína pode ser tratada para se inativar
micróbios patogênicosna presença ou na ausência de carbonatação, que pode
ser usada para proporcionar à bebida sabor e sensação na boca. Tipicamente,
o tratamento para a inativação de micróbios patogênicos é realizado no
acondicionamento individual usada para armazenamento e manipulação da
bebida com proteína. A bebida com proteína pode ser preparada a partir de um
concentrado de bebida com proteína, que pode encontrar-se em forma de um
concentrado de xarope ou de um concentrado em pó.
(71) Next Proteins, INC (US)
(72) Shawn Sherwood, David A. Jankins, Steven Anthony Rittmanic
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT US2007/063653 de 09/03/2007
(87) WO 2007/106731 de 20/09/2007
(21) PI 0708707-1 A2 (22) 02/03/2007
1.3
(30) 10/03/2006 US 11/276698
(51) B01F 5/20 (2006.01), B27N 1/02 (2006.01)
(54) APARELHO PARA TRATAMENTO DE UMA PLURALIDADE DE
PARTÍCULAS COM UM REVESTIMENTO
(57) APARELHO PARA TRATAMENTO DE UMA PLURALIDADE DE
PARTÍCULAS COM UM REVESTIMENTO. Um aparelho (20) para tratamento
de uma pluralidade de partículas, tal como sulfato de amônio, com um
revestimento, tal como uma cera, para evitar solidificação das partículas. Os
aparelhos incluem uma calha de alimentação (22), um difusor (26) e uma calha
de saída (24). Um aplicador é montado adjacente à base do difusor para a
pulverização do revestimento descendentemente além do difusor em um
modelo pré-definido. A calha de saída inclui um defletor (66) para dividir uma
cortina de partículas que caem do difusor e para redirecionar as partículas no
modelo pré-definido do revestimento. Um elemento de aquecimento (78) é
montado no defletor para manter uma temperatura pré-determinada do defletor
deste modo evitando o acúmulo do revestimento no defletor.
(71) Basf Se (DE)
(72) Jay R. Garner, Paul R. Meiller, Dominick A. Burlone, R. Merritt Sink, Judy
Easterling
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/051997 de 02/03/2007
(87) WO 2007/104661 de 20/09/2007
86
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/052314 de 12/03/2007
(87) WO 2007/104747 de 20/09/2007
(21) PI 0708708-0 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 GB 0604920.9; 18/07/2006 GB 0614260.8
(51) C07K 14/16 (2006.01), A61K 38/16 (2006.01), A61P 31/18 (2006.01)
(54) POLIPEPTÍDEIO TENDO NÃO MAIS DO QUE 100 AMINOÁCIDOS,
POLIPEPTÍDEO IMUNOGÊNICO DE EPÍTOPO MÚLTIPLO, COMPOSIÇÃO
DE POLIPEPTÍDEO, MÉTODO PARA PRODUZIR UM POLIPEPTÍDEO,
CONSTRUÇÃO DE POLIPEPTÍDEO, MÉTODO PARA PRODUZIR A MESMA,
COMPOSIÇÃO DE VACINA OU MEDICAMENTO CONTRA UM VÍRUS HIV,
MÉTODO PARA PRODUZIR UMA COMPOSIÇÃO DE VACINA OU
MEDICAMENTO, USO DE UM POLIPEPTÍDEO, UMA COMPOSIÇÃO DE
POLIPEPTÍDEO, UMA CONSTRUÇÃO DE POLIPEPTÍDEO OU UMA
COMPOSIÇÃO DE VACINA OU MEDICAMENTO
(57) POLIPEPTÍDEO TENDO NÃO MAIS DO QUE 100 AMINOÁCIDOS,
POLIPEPTÍDEO IMUNOGÊNICO DE EPÍTOPO MULTIPLO, COMPOSIÇÃO
DE POLIPEPTÍDEO, MÉTODO PARA PRODUZIR UM POLIPEPTÍDEO,
CONSTRUÇÃO DE POLIPEPTÍDEO, METODO PARA PRODUZIR A MESMA,
COMPOSIÇÃO DE VACINA OU MEDICAMENTO CONTRA UM VÍRUS HIV,
METODO PARA PRODUZIR UMA COMPOSIÇÃO DE VACINA OU
MEDICAMENTO, USO DE UM POLIPEPTÍDEO, UMA COMPOSIÇÃO DE
POLIPEPTÍDEO, UMA CONSTRUÇÃO DE POLIPEPTÍDEO OU UMA
COMPOSIÇÃO DE VACINA OU MEDICAMENTO. E fornecido um polipeptídeo
tendo não mais do que 100 aminoácidos, polipeptídeo este que compreende
uma ou mais sequências tendo pelo menos 60% de homologia com qualquer
uma das SEQ ID 1 a 4, ou compreende dois ou mais epítopos tendo 7
aminoácidos ou mais, cada epítopo tendo pelo menos 60% de homologia com
uma sub-sequência de qualquer uma das SEQ ID 1 a 4 que tem o mesmo
comprimento como o epítopo: SEQ ID 1 GDTWAGVEAHRILQQLLFT
HIFRIGCQHSR;
SEQ
ID
2
KVGSLQYLALTAIITPKKJKYPLPSVKKL
TEDRWNKPQKT; SEQ TD 3 EPVPLQLPPLERLTLDCSEDCGTSGT Q; SEQ ID
4 YKGALDLSHTLKEKGGLEGLIYSQKRQDILDLWVYIT TQGYFPD em que, o
polipeptídeo é imunogênico em um vertebrado que expressa um alelo de
complexo de histocompatibilidade maior (MHC), e em que o polipeptídeo não é
uma proteína do vírus HIV completa.
(71) Peptcell Limited (GB)
(72) Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT GB2007/000812 de 09/03/2007
(87) WO 2007/104932 de 20/09/2007
(21) PI 0708709-8 A2 (22) 12/03/2007
1.3
(30) 10/02/2006 EP 06004999.6; 10/03/2006 US 60/781398
(51) A61K 9/20 (2006.01), B29C 47/00 (2006.01), B29C 47/60 (2006.01), B29C
31/00 (2006.01), B29C 47/10 (2006.01), B29C 47/38 (2006.01), B29C 47/40
(2006.01), B29C 47/64 (2006.01), B29C 47/76 (2006.01), B29C 47/82 (2006.01)
(54) PROCESSO PARA PRODUZIR UMA DISPERSÃO SÓLIDA DE UM
INGREDIENTE ATIVO
(57) PROCESSO PARA PRODUZIR UMA DISPERSÃO SÓLIDA DE UM
INGREDIENTE ATIVO. Um processo para produzir uma dispersão sólida de um
ingrediente ativo que compreende alimentar o ingrediente ativo e um agente
formador de matriz a uma extrusora e formar um extrusado uniforme, em que a
extrusora compreende pelo menos duas árvores rotativas (2), cada uma das
árvores (2) portando uma pluralidade de elementos de processamento
dispostos axialmente um atrás do outro, os elementos de processamento
definindo (i) uma seção de alimentação e transporte (A), (ii) pelo menos uma
seção de misturação (B), e (iii) uma seção de descarga (E), em que o(s)
elemento(s) de processamento definindo a seção de misturação (B)
compreende(m) um elemento de misturação (11, 12, 13) que é derivado de um
elemento de tipo parafuso (figura 2).
(71) Aboott Gmbh & Co. Kg (DE)
(72) Thomas Kessler, Jörg Breitenbach, Christoph Schmidt, Matthias
Degenhardt, Jörg Rosenberg, Harald Krull
(21) PI 0708711-0 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/780,946; 07/02/2007 US 60/888,634
(51) C07K 14/415 (2006.01), C12N 15/82 (2006.01)
(54) POLINUCLEOTÍDEO ISOLADO, VETOR, CONTRUÇÃO DE DNA
RECOMBINANTE, MÉTODO PARA TRANSFORMAR UMA CÉLULA ,
MÉTODO PARA PRODUZIR UMA PLANTA, MÉTODO PARA CONFERIR OU
APRIMORAR A RESISTÊNCIA A PELO MENOS UM, DOIS, TRÊS, QUATRO,
CINCO HERBICIDA(S), MÉTODO PARA ALTERAR O NÍVEL DE EXPRESSÃO
DE UMA PROTEÍNA CAPAZ DE CONFERIR RESISTÊNCIA A PELO MENOS
UM, DOIS, TRÊS, QUATRO, CINCO HERBICIDA(S) EM UMA CÉLULA DE
PLANTA, MÉTODO PARA DETERMINAR A PRESENÇA DO LOCUS NSF1 EM
UMA PLANTA, E MÉTODO PRA OBTER UMA PLANTA DE SOJA
(57) POLINUCLEOTIDEO ISOLADO, VETOR, CONSTRUÇÃO DE DNA
RECOMBINANTE, METODO PARA TRANSFORMAR UMA CÉLULA, MÉTODO
PARA PRODUZIR UMA PLANTA, METODO PARA CONFERIR OU
APRIMORAR A RESISTENCIA A PELO MENOS UM, DOIS, TRES, QUATRO,
CINCO HERBICIDA (5), METODO PARA ALTERAR O NÍVEL DE EXPRESSAO
DE UMA PROTEÍNA CAPAZ DE CONFERIR RESISTÉNCIA A PELO MENOS
UM, DOIS, TRES, QUATRO, CINCO HERBICIDA(S) EM UMA CÉLULA DE
PLANTA, METODO PARA DETERMINAR A PRESENÇA DO LOCUS NSF1 EM
UMA PLANTA, E METODO PARA OBTER UMA PLANTA DE SOJA. Esta
invenção refere-se à seqüências de polinucleotídeos codificantes de um gene
que podem conferir resistência a pelo menos um herbicida. Esta ainda se refere
a plantas e sementes de plantas portadoras de genes quiméricos que
compreendem as referidas sequências de polinucleotideos, que ampliam ou
conferem resistência a pelo menos um herbicida, e métodos para produzir tais
plantas e sementes. A invenção ainda apresenta seqüências que podem ser
usadas como marcadores moleculares, que por sua vez podem ser usados para
identificar a região de interesse em linhagens de milho resultantes de
novoscruzamentos e para, de forma rápida e eficiente, identificar as melhores
linhagens para estratégias de melhoramento, evitando linhagens sensíveis.
(71) E.I. DUPONT DE NEMOURS & COMPANY (US)
(72) Thao Dam, Anthony D. Guida Jr., Christine B. Hazel, Bailin Li, Mark E.
Williams
(74) Claudia Christina Schulz
(85) 09/09/2008
(86) PCT US2007/006090 de 09/03/2007
(87) WO 2007/103567 de 13/09/2007
(21) PI 0708712-8 A2 (22) 07/03/2007
1.3
(30) 15/03/2006 US 11/377.233
(51) E21B 43/16 (2006.01), E21B 43/26 (2006.01)
(54) PROCESSO PARA A INIBIÇÃO DE ACIDIFICAÇÃO EM UM
RESERVATÓRIO DE HIDROCARBONETO
(57) PROCESSO PARA A INIBIÇAO DE ACIDIFICAÇÂO EM UM
RESERVATORIO DE HIDROCARBONETO. Um processo para inibição de
acidificação em um reservatório de hidrocarboneto provê uma água de
alimentação que inclui uma pluralidade de constituintes fosforosos e tendo uma
concentração de fósforo elevada. Pelo menos parte dos constituintes fosforosos
é removida da água de alimentação para a produção de uma água de injeção
tratada, a qual tem uma concentração de fósforo reduzida menor do que a
concentração de fósforo elevada. A água de injeção tratada é injetada no
reservatório através de um primeiro poço e o hidrocarboneto é produzido a
partir do reservatório através de um segundo poço. O processo inibe a
acidificação no reservatório, à medida que a água de injeção tratada resulta em
um nível mais baixo de acidez no reservatório ao longo do tempo do que se a
água de alimentação tivesse sido injetada no reservatório.
(71) Marathon Oil Company (US)
(72) John E. McElhiney
(74) Orlando De Souza
(85) 09/09/2008
(86) PCT US2007/063486 de 07/03/2007
(87) WO 2007/106691 de 20/09/2007
(21) PI 0708713-6 A2 (22) 02/03/2007
1.3
(30) 10/03/2006 US 60/781022; 14/07/2006 US 60/830981
(51) A01N 37/36 (2006.01), A01N 43/653 (2006.01), A01N 47/24 (2006.01),
A01N 37/50 (2006.01), A01N 43/54 (2006.01), A01N 43/40 (2006.01)
(54) USO DE UM COMPOSTO ATIVO, E, MÉTODO PARA MELHORAR A
TOLERÂNCIA DAS PLANTAS ÀS BAIXAS TEMPERATURAS
(57) USO DE UM COMPOSTO ATIVO, E, MÉTODO PARA MELHORAR A
TOLERÂNCIA DAS PLANTAS ÀS BAIXAS TEMPERATURAS. A presente
invenção diz respeito ao uso de um composto ativo que inibe a cadeia
respiratória mitocondrial no nível do complexo b/c1 para melhorar a tolerância
das plantas às baixas temperaturas.
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 87
(71) Basf SE (DE)
(72) Wilhelm Rademacher, Harald Köhle, Vince Ulstad
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/051996 de 02/03/2007
(87) WO 2007/104660 de 20/09/2007
(21) PI 0708714-4 A2 (22) 23/01/2007
1.3
(30) 10/03/2006 GB 0604790.6; 24/03/2006 GB 0605993.5; 24/03/2006 GB
0605958.8; 27/03/2006 GB 0606089.1; 06/07/2006 GB 0613483.7
(51) A24D 3/04 (2006.01)
(54) ELEMENTO DE FILTRO, FILTRO, E, ARTIGO PARA FUMAR
(57) ELEMENTO DE HLTRO, FILTRO, E, ARTIGO PARA FUMAR. Um
elemento de filtro que tem um núcleo que se estende longitudinalmente e um
invólucro (8) preso em tomo do núcleo, em que o núcleo compreende material
de filtração (6) e opcionalmente um material particulado (7) intercalado no
material de filtração e o invólucro (8) compreende um material particulado (9)
aderido a duas ou mais porções do dito invólucro (8) em que pelo menos uma
das ditas duas ou mais porções estende-se por todo o comprimento longitudinal
do dito invólucro. Também é explicado aqui um artigo para fumar que
compreende o dito elemento filtrante e/ou filtro que compreende o dito elemento
filtrante.
(71) British American Tobacco (Investments) Limited (GB)
(72) Peter Rex White, Martin Graham Duke, William David Lewis
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT GB2007/000197 de 23/01/2007
(87) WO 2007/104908 de 20/09/2007
(21) PI 0708715-2 A2 (22) 08/03/2007
1.3
(30) 10/03/2006 US 60/781243
(51) G05D 16/10 (2006.01)
(54) DISPOSITIVO REGULADOR DE FLUXO E REGULADOR PARA
CONTROLAR UM FLUXO DE FLUIDO ENTRE UM ORIFÍCIO DE ENTRADA E
UM ORIFÍCIO DE SAÍDA
(57) DISPOSITIVO REGULADOR DE FLUXO E REGULADOR PARA
CONTROLAR UM FLUXO DE FLUIDO ENTRE UM ORIFÍCIO DE ENTRADA E
UM ORIFÍCIO DE SAÍDA. A presente invenção é dirigida a um dispositivo
regulador de fluxo para controlar o fluxo de um fluido entre um orificio de
entrada e um orificio de saída e tendo um mecanismo de ajuste interno para
variar a pressão de saída no dispositivo inclusive a pressão requerida para
fechar a válvula. O dispositivo pode incluir primeiro e segundo componentes, tal
como um corpo e um tampo removivelmente afixados para formar um
alojamento do dispositivo e definir uma cavidade de dispositivo interna. Um
êmbolo é disposto e deslocável no interior da cavidade do dispositivo e em
relação vedante de fluido com a superficie interna da cavidade do dispositivo.
Os componentes e o êmbolo são configurados para definir um canal no interior
da cavidade do dispositivo dispondo o orificio de entrada em comunicação fluida
com o orificio de saída e com o êmbolo sendo deslocável entre uma posição
fechada prevenindo o fluxo de fluido e uma posição aberta permitindo o fluxo de
fluido no orificio de saída. O mecanismo de ajuste interno pode ser na forma de
uma roda que pode ser girada em uma e outra direção para aumentar ou
decrescer a pressão de saída em que o êmbolo se deslocará para a posição
fechada. Um orificio de exaustão deslocado do eixo geométrico longitudinal do
alojamento pode proporcionar acesso ao interior do dispositivo para
manipulação do mecanismo de ajuste.
(71) Fisher Controls International LLC (US)
(72) Eric W. Neumann, Todd William Larsen
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT US2007/005990 de 08/03/2007
(87) WO 2007/106374 de 20/09/2007
(21) PI 0708716-0 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 US 60/781.523
(51) A23K 1/18 (2006.01), A23K 1/16 (2006.01)
(54) MÉTODOS E COMPOSIÇÕES PARA PRODUTIVIDADE AUMENTADA
EM ANIMAIS
(57) MÉTODOS E COMPOSIÇÕES PARA PRODUTIVIDADE AUMENTADA
EM ANIMAIS. Métodos de desempenho e produtividade melhorada em animais
alimentando-se uma composição de alimento animal ou suplemento de alimento
de animal compreendendo um produto de capsaicina são descrito. Os métodos
e sistemas de alimentar de alimentação compreendendo alimentar o animal
uma composição de alimento animal ou suplemento de alimento de animal
compreendendo o produto de capsaicina são também descrito. As composições
incluindo um produto de capsaicina também são descrito.
(71) Archer-Daniels-Midland Company (US)
(72) Stephanie S. Block, Michael J. Cecava, Perry H. Doane, Mark A. Franklin,
L. Christopher Kamel, Nathan A. Pyatt, Hong Yang
(74) Nellie Anne Daniel - Shores
(85) 09/09/2008
(86) PCT US2007/006247 de 09/03/2007
(87) WO 2007/106452 de 20/09/2007
(21) PI 0708717-9 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 US 60/781004
(51) A01P 7/00 (2006.01), A01P 7/04 (2006.01), A01P 5/00 (2006.01), A01P
9/00 (2006.01), A01N 25/10 (2006.01), A01N 25/14 (2006.01), A01N 47/02
(2006.01)
(54) COMPOSIÇÃO PESTICIDA, PROCESSO PARA FABRICAÇÃO DE UM
MATERIAL GRANULAR ABSORVENTE DE ÁGUA, USO DA COMPOSIÇÃO,
E, MÉTODO PARA COMBATER PRAGAS ARTRÓPODES, CARACÓIS E
NEMATÓIDES QUE VIVEM NO SOLO
(57) COMPOSIÇÃO PESTICIDA, PROCESSO PARA FABRICAÇÃO DE UM
MATERIAL GRANULAR ABSORVENTE DE ÁGUA, USO DA COMiPOSIçÁO,
E, METODO PARA COMBATER PRAGAS ARTRÓPODES, CARACÓIS E
NEMATÓIDES QUE VIVEM NO SOLO. A presente invenção refere-se a uma
composição pesticida na forma de um material granular absorvente de água e
ao uso dessas composições para combater pragas artrópodes, em particular
pragas artrópodes que vivem no solo, e nematóides, com particular preferência
dada a insetos-praga que vivem no solo. A composição pesticida de acordo
com a invenção como um material granular absorvente de água, que contém: i)
de 0,00 1 a 10% em peso de pelo menos um composto pesticida, em particular
um composto pesticida que seja ativo contra a referida praga artrópode que vive
no solo, ii) de 80 a 99,999% em peso de pelo menos um polímer granular super
absorvente, e iii) água, em que as %s em peso são baseadas no peso total da
composição, exceto pela água e em que os componentes i) e ii) formam pelo
menos 90% em peso da composição exceto pela água, e em que o material
granular absorvente de água pode ser obtido por um processo que compreende
o tratamento de grânulos de polímero superabsorvente com uma composição
líquida aquosa contendo o pelo menos um composto pesticida.
(71) Basf SE (DE)
(72) Claude Taranta, Thomas Bork, Wolfgang Meier, Ronald Wilhelm, Matthias
Bratz, Keith A. Holmes, Eric Cazeneuve, Hassan Olomi-Sadeghi, Mark Coffelt
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/052244 de 09/03/2007
(87) WO 2007/104720 de 20/09/2007
(21) PI 0708718-7 A2 (22) 09/03/2007
1.3
(30) 11/03/2006 DE 10 2006 011 295.4; 27/04/2006 US 60/795666
(51) F24J 2/52 (2006.01)
(54) GERADOR DE ENERGIA SOLAR, FIAÇÃO DO CORPO OCO,
PROCESSO PARA UNIR POR FLANGE DE ACOPLAMENTO O CONVERSOR
DE ENERGIA EM UM CORPO OCO, E, CONCENTRADORES QUE FLUTUAM
SOBRE UMA CAMADA DE ÁGUA PARA O USO DE ENERGIA SOLAR
(57) GERADOR DE ENERGIA SOLAR, FIAÇÃO DO CORPO OCO,
PROCESSO PARA UNIR POR FLANGE DE ACOPLAMENTO O CONVERSOR
DE ENERGIA EM UM CORPO OCO, E, CONCENTRADORES QUE FLUTUAM
SOBRE UMA CAMADA DE ÁGUA PARA O USO DE ENERGIA SOLAR. A
88
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
invenção refere-se a um gerador de energia solar com concentradores de
irradiação solar especiais, configurados como corpos ocos, bem como a
concentradores deste tipo propriamente ditos. Em particular, a invenção referese a um gerador de energia solar com módulos dispostos sobre uma camada
de água, os quais contêm um conversor de irradiação, em que uma
multiplicidade de módulos é reunida para formar corpos flutuantes que
apresentam uma parede que é subdividida e regiões translúcidas e opacas.
(71) Nikolaus Johannes Laing (DE)
(72) Andreas Hesse, Nikolaus Johannes Laing, Inge Laing
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT EP2007/002081 de 09/03/2007
(87) WO 2007/104490 de 20/09/2007
(21) PI 0708719-5 A2 (22) 07/03/2007
1.3
(30) 10/03/2006 US 60/781452
(51) C10L 1/16 (2006.01)
(54) MELHORADOR DE ÍNDICE DE VISCOSIDADE POLIMÉRICA,
COMPOSIÇÃO OLEOSA, E, CONCENTRADO POLIMÉRICO PARA
COMPOSIÇÕES OLEOSAS
(57) MELHORADOR DE ÍNDICE DE VISCOSIDADE POLIMERICA,
COMPOSIÇÃO OLEOSA, E, CONCENTRADO POLIMERICO PARA
COMPOSIÇÕES OLEOSAS. Um melhorador do índice de viscosidade
polimérica que inclui um copolímero em bloco hidrogenado tendo pelo menos
um copolímero embloco de distribuição controlada tendo uma cristalinidade
melhorada é fornecido. Uma composição oleosa incluindo pelo menos um óleo
base e o melhorador do índice de viscosidade já mencionado também é
fornecido. Um concentrado polimérico que inclui o melhorador do índice de
viscosidade já mencionado é ainda fornecido.
(71) Kraton Polymers U.S. LLC (US)
(72) David John St. Clair
(74) Momsen, Leonardos & CIA.
(85) 09/09/2008
(86) PCT US2007/005728 de 07/03/2007
(87) WO 2007/106346 de 20/09/2007
(21) PI 0708720-9 A2 (22) 02/03/2007
1.3
(30) 02/03/2006 US 60/778,704
(51) G02F 1/135 (2006.01)
(54) DISPOSITIVO ÓPTICO; E MÉTODO PARA A PRODUÇÃO DE UM
DISPOSITIVO ÓPTICO DE MÚLTIPLAS CAMADAS
(57) DISPOSITIVO ÓPTICO; E MÉTODO PARA A PRODUÇÃO DE UM
DISPOSITIVO ÓPTICO DE MULTIPLAS CAMADAS. Trata-se de um dispositivo
óptico possui uma primeira camada de barreira eletricamente isolante disposta
sobre uma primeira camada de eletrodo, uma camada fotocondutiva disposta
sobre a primeira camada de barreira, e uma camada de confinamento da
portadora disposta sobre a camada de fotocondução. A camada de
confinamento da portadora define um volume por todo o qual uma pluralidade
de armadilhas de portadora é dispersa. Além disso, uma segunda camada de
barreira eletricamente isolante é disposta sobre a camada de confinamento da
portadora, uma camada de bloqueio de luz é disposta sobre a segunda camada
de barreira de modo a bloquear a luz de uma banda de comprimento de onda
selecionada. Uma camada refletiva é disposta sobre a camada de bloqueio de
luz de modo a refletir luz dentro da banda de comprimento de onda
selecionada, uma camada birrefringente ou dispersiva é disposta sobre a
camada refletiva, e uma segunda camada de eletrodo opticamente transmissiva
é disposta sobre a camada birrefringente ou dispersiva. Um método é também
apresentado, assim como camadas adicionais intervenientes entre as
detalhadas acima.
(71) Compound Photonics (US)
(72) Jonathan A. Sachs, Jerry M. Woodall
(74) Araripe & Associados
(85) 02/09/2008
(86) PCT US2007/005531 de 02/03/2007
(87) WO 2007/103274 de 13/09/2007
(21) PI 0708721-7 A2 (22) 27/02/2007
1.3
(30) 27/02/2006 US 60/777,165; 26/02/2007 US 11/678,981
(51) A23B 7/10 (2006.01), A23K 1/00 (2006.01)
(54) APARELHO E MÉTODO PARA CONTROLAR A COMPOSIÇÃO GASOSA
PRODUZIDA DURANTE A GASEIFICAÇÃO DE ALIMENTAÇÕES CONTENDO
CARBONO
(57) APARELHO E MÉTODO PARA CONTROLAR A COMPOSIÇÃO GASOSA
PRODUZIDA DURANTE A GASEIFICAÇÃO DE ALIMENTAÇÕES CONTENDO
CARBONO. Método para controlar a composição de saí da de um dispositivo de
gaseificação para uso na gaseificação de biomassa utilizando um gaseificador
em que a biomassa e o gás, ambos fluem numa direção descendente. O
método combina o uso de vapor e oxigênio como um fluxo de oxidação misto
para controlar os processos que ocorrem dentro do gaseificador. Os oxidantes
são introduzidos no gaseificador utilizando numerosos anéis de injeção. Cada
anel de injeção compreende numerosos bocais injetores (28, 29) cada um
radialmente distribuído na mesma altura vertical e possivelmente conectados a
mesma fonte de suprimento. Particularmente, resultados satisfatóúos podem
ser alcançados pelo uso de três anéis de injeção, um no topo do gaseificador,
um na interface da zona de oxidação e redução e um a uma pequena distância
abaixo da montagem da grade (25). O gás de síntese produzido também
contém concentrações extremamente baixas de alcatrão e hidrocarbonetos de
baixo peso molecular.
(71) Zero-Point Clean Tech, Inc. (US)
(72) Philip D. Leveson
(74) Araripe & Associados
(85) 27/08/2008
(86) PCT US2007/062861 de 27/02/2007
(87) WO 2007/101186 de 07/09/2007
(21) PI 0708722-5 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 GB 0604822.7
(51) A61K 31/137 (2006.01), A61P 29/00 (2006.01), A61P 19/00 (2006.01),
A61P 11/00 (2006.01), A61P 11/06 (2006.01), A61P 1/00 (2006.01), A61P
17/06 (2006.01), A61P 17/00 (2006.01), A61P 1/02 (2006.01), A61P 37/00
(2006.01), A61P 27/00 (2006.01), A61P 27/04 (2006.01)
(54) USO DE BETA-AMINOÁLCOOIS NO TRATAMENTO DE DOENÇAS
INFLAMATÓRIAS E DORES
(57) USO DE BETA-AMINOÁLCOOIS NO TRATAMENTO DE DOENÇAS
INFLAMATÓRIAS E DORES. Um composto para uso terapêutico, de fórmula
(1), em que R1 é arila ou heteroarila opcionalmente substituído com R5; R2 é H,
RPI 2109 de 07/06/2011
alquila ou CH2OH ou forma parte de um anel com R4; R3 é H, alquila ou CH2OH
ou forma parte de um anel com R4; R4 é H, alquila ou (quando forma parte de
um anel com R2 ou R3) CH2; e R5 é alquila, CF3, OH, Oalquila, OCOalquila,
CONH2, CN, haloqênio, NH2, NO2, NHCHO, NHCONH2, NHSO2Me, ou SOMe;
ou um sal dos mesmos.
(71) Sosei R&D Ltd. (GB)
(72) John Brew
(74) Montaury Pimenta, Machado & Lioce
(85) 09/09/2008
(86) PCT GB2007/000816 de 09/03/2007
(87) WO 2007/102008 de 13/09/2007
(21) PI 0708723-3 A2 (22) 12/03/2007
1.3
(30) 10/03/2006 GB 0604907.6
(51) F23G 5/027 (2006.01), F23G 5/40 (2006.01), F23J 15/04 (2006.01)
(54) INSTRUMENTO E MÉTODO DE TRATAMENTO DE RESÍDUOS
(57) INSTRUMENTO E MÉTODO DE TRATAMENTO DE RESIDUOS. O
presente pedido se refere a um instrumento e a um método para tratamento de
resíduos por pirólise, nos quais os resíduos tratados são descarregados por
uma grade (18) para uma armadilha de material reciclável na câmara de pirólise
(24). A pirólise é realizada a uma temperatura dentro da faixa de 400 a 700 ºC.
Os gases de exaustão são dissolvidos em uma solução dentro do depurador de
gás (13) para a distribuição/despejo em água corrente. A água é introduzida
para a câmara como vapor superaquecido através de canos (5) , de forma que
tanto o material tratado seja descarregado, como também a câmara seja limpa.
O resíduo reciclável é separado do não reciclável pelo tratamento do resíduo
não reciclável por pirólise, e pelo descarte do resíduo não reciclável através de
exaustor de líquidos (8). O instrumento é montado como uma unidade modular,
independente e compreende pinos de tomada para conexão a um fornecedor
de eletricidade, a um fornecedor de água, e a um sistema de esgoto (16) e
contém uma câmera com um volume na faixa de 0,01 a 0,5 m3.
(71) Morgan Everett Ltd (GB)
(72) Howard Morgan Clarke, Michael Benjamim Elder
(74) Soerensen Garcia Advogados Associados.
(85) 09/09/2008
(86) PCT GB2007/000853 de 12/03/2007
(87) WO 2007/104954 de 20/09/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 89
(21) PI 0708725-0 A2 (22) 09/03/2007
1.3
(30) 09/03/2006 US 60/780,526; 11/07/2006 US 60/819.864; 26/01/2007 US
60/897.667
(51) A61K 31/047 (2006.01), A61P 25/28 (2006.01)
(54) FORMULAÇÃO DE POLIÁLCOOL DE CICLOHEXANO PARA O
TRATAMENTO DE DOENÇAS DE AGREGAÇÃO DE PROTEÍNA
(57) FORMULAÇÃO DE POLIALCOOL DE CICLOHEXANO PARA O
TRATAMENTO DE DOENÇAS DE AGREGAÇAO DE PROTEÍNA. A invenção
fornece formulações, formas de dosagem e tratamento compreendendo
composto de poliálcool de ciclohexano que fornece perfil farmacocinéticos
benéficos no tratamento de uma condição e/ou doença incluindo uma condição
no dobramento de proteína e/ou agregação, e/ou formação de amilóide,
deposição, acúmulo ou permanência. Em aspectos da invenção, uma forma de
dosagem é fornecida compreendendo uma quantidade de composto de
poliálcool de ciclohexano adequada para administração a um indivíduo para
fornecer uma concentração terapeuticamente efetiva do composto no plasma,
cérebro, e/ou fluido espinhal cerebral e um veículo, diluente ou excipiente
farmaceuticamente aceitável. A formulação pode ser administrada em uma
dose de 500, 1000, 2000, 3500, 5000 ou 7000 mg do referido composto de
poliálcool de ciclohexano para alcançar um perfil médio de concentração de
plasma possuindo um AUCO-INF médio em µh/mL de, respectivamente, 43 ±
20%, 130 ± 20%, 215 ± 20%, 467 ± 20%, 507 ± 20% ou 885 ± 20%, e
possuindo um CMAX médio em µmL de, respectivamente, 5,8 ± 20%, 17 + 20%,
33 ± 20%, 75 ± 20%, 110 ± 20% ou 155 ± 20%.
(71) Waratah Pharmaceuticals, Inc (CA) , Joanne Mclaurin (CA)
(72) Joanne Mclaurin, Antonio Cruz
(74) Orlando de Souza
(85) 09/09/2008
(86) PCT CA2007/000395 de 09/03/2007
(87) WO 2007/101353 de 13/09/2007
(21) PI 0708726-8 A2 (22) 08/03/2007
1.3
(30) 09/03/2006 EP 06388016.5
(51) A01N 61/00 (2006.01), A01N 43/90 (2006.01), A01N 43/60 (2006.01),
A01N 43/22 (2006.01), A01N 43/40 (2006.01), A01N 43/16 (2006.01), A01P
7/00 (2006.01)
(54) COMPOSIÇÕES PESTICIDAS
(57) COMPOSIÇÕES PESTICIDAS. São apresentadas composições pesticidas
compreendendo pelo menos um pesticida selecionado dentre pesticidas
agonistas de canais de cloreto glutamato- ou GABA-dependentes e pelo menos
um sinergista o qual é selecionado dentre compostos de Vitamina E e
compostos de Niacina e derivados dos mesmos. As combinações desses
compostos mostram um efeito sinergístico, permitindo que a composição seja
preparada compreendendo uma menor quantidade de pesticida, ao mesmo
tempo em que ainda contra as pestes prejudiciais.
(71) Cheminova A/S (DK)
(72) Morten Pedersen, Henriette Sie Woldum
(74) Di Blasi, Parente, S. G. & Associados S/C
(85) 09/09/2008
(86) PCT DK2007/050030 de 08/03/2007
(87) WO 2007/101447 de 13/09/2007
(21) PI 0708727-6 A2 (22) 05/03/2007
1.3
(30) 09/03/2006 EP 06004831.1
(51) A61K 8/22 (2006.01), A61K 8/19 (2006.01), A61K 8/34 (2006.01), A61K
8/46 (2006.01), A61K 8/41 (2006.01), A61Q 5/08 (2006.01), A61Q 5/10
(2006.01)
(54) COMPOSIÇÕES ESPESSADAS PARA TINTURA E DESCOLORAÇÃO
DOS CABELOS
(57) COMPOSIÇÕES ESPESSADAS PARA TINTURA E DESCOLORAÇAO
DOS CABELOS. A presente invenção refere-se a composições para tingimento
e descoloração dos cabelos que compreendem uma fonte de jons carbonato, ao
menos um agente oxidante e um sistema espessante à base de rede de gel
específico que compreende um sistema tensoativo ternário especifico. As
composições da presente invenção surpreendentemente são composições
otimizadas para tintura e descoloração dos cabelos, e proporcionam melhor
clareamento e coloração, ao mesmo tempo em que minimizam os danos, além
de serem de fácil fabricação e terem estabilidade prolongada em prateleira.
(71) The Procter & Gamble Company (US)
(72) Andrei Sergeevich Bureiko, Anthony McMeekin
(74) Trench Rossi e Watanabe Advogados
(85) 09/09/2008
(86) PCT IB2007/050722 de 05/03/2007
(87) WO 2007/102119 de 13/09/2007
(21) PI 0708724-1 A2 (22) 26/02/2007
1.3
(30) 09/03/2006 DE 10 2006 010 939.2
(51) B03D 1/01 (2006.01)
(54) REAGENTE DE FLUTUAÇÃO PARA SILICATOS
(57) REAGENTE DE FLUTUAÇÃO PARA SILICATOS. A presente invenção
refere-se ao uso de um composto da fórmula (I) R1-O-R2-NH(2-m)-[(R3)nH] m (I),
em que R1 é um grupo hidrocarboneto tendo 1 a 40 átomos de carbono, R2 e
um grupo hidrocarboneto alifático tendo 2 a 4 átomos de carbono e R3 é um
grupo alcóxi, n está na faixa de 1 a 50 e m é 1 ou 2, reagente de flutuação para
silicato.
(71) Clariant International LTD (CH)
(72) Klaus-Ulrich Pedain, Tobias Rau
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 09/09/2008
(86) PCT EP2007/001628 de 26/02/2007
(87) WO 2007/101575 de 13/09/2007
(21) PI 0708728-4 A2 (22) 15/03/2007
1.3
(30) 15/03/2006 US 11/376,981
(51) G06Q 30/00 (2006.01), G06Q 20/00 (2006.01)
(54) SISTEMA, MÉTODO E EQUIPAMENTO DE DINHEIRO VIRTUAL DE
COMÉRCIO MÓVEL
(57) SISTEMA, METODO E EQUIPAMENTO DE DINHEIRO VIRTUAL DE
COMERCIO MÓVEL. Um sistema de dinheiro virtual, método e equipamento
possui um registro de conta contendo um registro das quantias de moeda
corrente associadas com um dispositivo sem fio e um transmissor para
transmitir sem fio para o dispositivo sem fio informação predeterminada do
registro de conta. As quantias em dinheiro podem ser gastas a partir do registro
de conta diretamente do dispositivo sem fio através da informação derivada do
dispositivo sem fio através de um código de barra no display, um sinal de rádio
de curto alcance, um feixe de luz, ou similar. Um código de segurança diferente
é gerado para cada transação de conta para verificação.
(71) Qualcomm Incorporated (US)
(72) Joan T. Waltman
(74) Montaury Pimenta, Machado & Lioce S/C Ltda
(85) 09/09/2008
90
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(86) PCT US2007/064108 de 15/03/2007
(87) WO 2007/106906 de 20/09/2007
(21) PI 0708729-2 A2 (22) 09/03/2007
1.3
(30) 08/03/2007 US 11/715,622; 09/03/2007 US 60/780,587
(51) A62B 7/00 (2006.01)
(54) CONJUNTO DE CONDUÍTE MULTISSECCIONADO
(57) CONJUNTO DE CONDUITE MULTISSECCIONADO. É divulgado um
conjunto de conduíte (18) que distribui um fluxo de gás respirável na via aérea
de um usuário. O conjunto de conduíte inclui um primeiro segmento flexível
(34a, 52a, 84a) com uma primeira parte de extremidade, uma segunda parte de
extremidade e um primeiro espaço ali definido da primeira parte de extremidade
até a segunda parte de extremidade. O conjunto de conduíte também inclui um
segundo segmento flexivel (34b, 52b, 84b) com uma terceira parte de
extremidade, uma quarta parte de extremidade e um segundo espaço ali
definido da terceira parte de extremidade até a quarta parte de extremi-dade.
Um primeiro conector giratório (36a, 54, 86a) é acoplado na segunda parte de
extremidade do primeiro segmento e na terceira parte de extremidade do
segundo segmento de maneira tal que o primeiro segmento seja rotacionável
em relação ao segundo segmento.
(71) Ric Investments, INC. (US)
(72) Peter Chi Fai Ho
(74) Nellie Anne Daniel Shores
(85) 09/09/2008
(86) PCT US2007/063686 de 09/03/2007
(87) WO 2007/104045 de 13/09/2007
(21) PI 0708730-6 A2 (22) 09/03/2007
1.3
(30) 10/03/2007 US 11/372,957
(51) H01R 24/00 (2006.01)
(54) RECEPTÁCULO COM CONJUNTO DE CONTATOS OTIMIZANDO
DIAFONIA
(57) RECEPTÁCULO COM CONJUNTO DE CONTATOS OTIMIZANDO
DIAFONIA. Uma montagem de receptáculo compreende um alojamento (108)
tendo extremidades dianteira (102) e traseira (104). A extremidade dianteira
recebe um plugue e a extremi- dade traseira admite contatos de terminação de
fio (113). Uma placa de circuitos (148) tem uma pluralidade de furos de contato
(188, 190) e é retida dentro do alojamento. Uma pluralidade de contatos de
conjunto (124, 126, 128, 130, 132, 134, 136, 138) é arranjada em um conjunto
de contatos (106) dentro do alojamento. Cada um da pluralidade de contatos de
conjunto compreende uma seção principal (218) e uma seção traseira (216). A
seção principal se desenvolve de uma maneira geral perpendicular à placa de
circuitos. A seção traseira tem uma primeira dobra formando uma primeira
subseção traseira (228) se estendendo paralela à placa de circuitos e uma
segunda dobra formando uma segunda subseção traseira (222) se estendendo
perpendicular à placa de circuitos. A segunda subseção traseira de cada um da
pluralidade de contatos de conjunto é recebida por um furo da pluralidade de
furos de contato na placa de circuitos.
(71) Tyco Electronics Corporation (US)
(72) Linda Ellen Shields, Paul John Pepe
RPI 2109 de 07/06/2011
(74) Nellie Anne Daniel Shores
(85) 09/09/2008
(86) PCT US2007/006123 de 09/03/2007
(87) WO 2007/106409 de 20/09/2007
(21) PI 0708731-4 A2 (22) 09/03/2007
1.3
(30) 10/03/2006 JP 2006-066451
(51) C07D 401/12 (2006.01), A61K 31/4545 (2006.01), A61K 31/496 (2006.01),
A61K 31/5377 (2006.01), A61K 31/549 (2006.01), A61K 31/554 (2006.01),
A61P 1/04 (2006.01), A61P 1/16 (2006.01), A61P 9/00 (2006.01), A61P 11/02
(2006.01), A61P 11/06 (2006.01), A61P 13/12 (2006.01), A61P 17/06 (2006.01),
A61P 19/02 (2006.01), A61P 25/00 (2006.01), A61P 27/02 (2006.01), A61P
29/00 (2006.01), A61P 31/00 (2006.01), A61P 31/12 (2006.01), A61P 31/18
(2006.01), A61P 37/00 (2006.01), A61P 37/08 (2006.01), A61P 43/00 (2006.01),
C07D 401/14 (2006.01), C07D 417/14 (2006.01), C07D 419/14 (2006.01), A61P
37/06 (2006.01)
(54)
DERIVADO
HETEROCÍCLICO
NITROGENADO,
E
AGENTE
FARMACÊUTICO COMPREENDENDO O DERIVADO COMO INGREDIENTE
ATIVO
(57)
DERIVADO
HETEROCICLICO
NITROGENADO,
E
AGENTE
FARMACEUTICO COMPREENDENDO O DERIVADO COMO INGREDIENTE
ATIVO. O composto representado pela fórmula (Y), um sal do mesmo, um Nóxido do mesmo, um solvato do mesmo, ou um pró-fármaco do mesmo
especificamente ser liga a CCR5, sendo útil para prevenir e/ou tratar doenças
relacionadas com CCR5, por exemplo, diversas doenças inflamatórias (asma,
nefrite, nefropatia, hepatite, artrite, artrite reumatóide, rinite, conjuntivite, colite
ulcerativa, etc.), doenças imunológicas (doenças autoimunes, rejeição em
transplante de órgáos, imunosupressão, psoríase, esclerose múltipla, etc.),
doenças infecciosas (infecção com vírus da imunodeficiência humana,
síndrome da imunodeficiência adquirida, etc.), doenças alérgicas (dermatite
atópica, urticária, aspergilose broncopulmonar alérgica, gastrenterite
eosinofílica alérgica, etc.), lesão de reperfusão isquêmica, síndrome do
desconforto respiratório agudo, choque associado à infecção bacteriana,
diabetes, metástase de câncer e assim por diante. Onde todos os simbolos na
fórmula são como definido no relatório descritivo.
(71) Ono Pharmaceutical CO. LTD. (JP)
(72) Shinya Kusuda, Toshihiko Nishiyama, Kasuya Hashimura, Junya Ueda,
Shiro Shibayama
(74) Nellie Anne Daniel Shores
(85) 09/09/2008
(86) PCT JP2007/054684 de 09/03/2007
(87) WO 2007/105637 de 20/09/2007
(21) PI 0710741-2 A2 (22) 12/04/2007
1.3
(30) 14/04/2006 FR 06 06682
(51) C07D 213/40 (2006.01), C07D 405/12 (2006.01), C07D 213/42 (2006.01),
C07D 401/06 (2006.01), C07D 401/12 (2006.01), A61K 31/4427 (2006.01),
A61P 25/00 (2006.01), A61P 29/00 (2006.01)
(54) DERIVADO DE AMINO METIL PIRIDINA, O RESPECTIVO PREPARO E A
RESPECTIVA APLICAÇÃO EM TERAPÊUTICA
(57) DERIVADO DE AMINO METIL PIRIDINA, O RESPECTIVO PREPARO E A
RESPECTIVA APLICAÇÃO EM TERAPÊUTICA. A presente invenção refere-se
a compostos correspondentes à fórmula: (I) na qual: Z representa um grupo
N(R3)XR4, N(R3)COOR5 ou O- CON(R3)R5; x representa um grupo -CO-, - S02-,
-CON(R6)- ou -CSN(R6)-; - R1 e R2 representam cada um independentemente
um do outro um átomo de hidrogênio ou um (C1,-C7)alquila ou juntos com o
átomo de nitrogênio ao qual são ligados constituem um radical heterocíclico
saturado ou insaturado; - R3 e Rg representa um átomo de hidrogênio ou um
grupo (C1-C4) alquila; - representa: um grupo (C3-C10) alquila/ um radical
carbocíclico; um radical heterocíclico; um indolila; um tetra-hidronaftalenila, um
naftalenila; um benzotiofenila ou um benzorrurila; um fenila, um benzodioxila;
um fenóxi metileno 1-fenóxi etileno; um fenil ciclopropila; R5 representa um
fenila; A1 e Ar2 representa cada um independentemente um do outro um fenila
não substituído ou substituído; n representa 0,1 ou 2; Alq representa um grupo
(C1-C7)alquila; no estado de base ou de sal de adição, assim como no estado
de hidrato ou de solvato.
(71) Sanofi-Aventis (FR)
RPI 2109 de 07/06/2011
(72) Francis Barth, Christian Congy, Philippe Pointeau, Murielle RinaldiCarmona, Lionel Barre
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 14/10/2008
(86) PCT FR2007/000620 de 12/04/2007
(87) WO 2007/119001 de 25/10/2007
(21) PI 0710743-9 A2 (22) 13/04/2007
1.3
(30) 13/04/2006 US 60/791,954; 12/04/2007 US 11/786,736
(51) B29C 49/46 (2006.01)
(54) MOLDAGEM POR SOPRO HIDRÁULICA OU LÍQUIDA
(57) MOLDAGEM POR SOPRO HIDRAULICA OU LÍQUIDA. Um aparelho e um
método para formar e encher simultaneamente um recipiente plástico é provido.
Uma cavidade de molde define uma superfície interna e é adaptado para aceitar
a pré-forma. Uma fonte de pressão inclui uma entrada e um dispositivo
semelhante a pistão. O dispositivo semelhante a pistão é móvel em uma
primeira direção, em que líquido é impelido para dentro da fonte de pressão
através da entrada e em uma segunda direção em que o líquido é expelido em
direção à pré-forma. Um bocal de sopro pode ser adaptado para receber liquido
da fonte de pressão e transferir liquido a uma alta pressão para a pré- forma,
impelindo a pré-forma a expandir em direção à superfície interna da cavidade
de molde e criar um recipiente resultante. O liquido permanece dentro do
recipiente como um produto final.
(71) Amcor Limited (AU)
(72) David Andison, David G. Lisch, Dan Weissmann
(74) Di Blasi, Parente, Vaz e Dias & Al
(85) 13/10/2008
(86) PCT US2007/009097 de 13/04/2007
(87) WO 2007/120807 de 25/10/2007
(21) PI 0710744-7 A2 (22) 11/04/2007
1.3
(30) 13/04/2006 US 60/791,850
(51) C07C 17/08 (2006.01)
(54) PROCESSO DE PRODUÇÃO DE BROMETO DE N-PROPIL OU OUTROS
BROMETOS ALIFÁTICOS
(57) MOLDAGEM POR SOPRO HIDRAULICA OU LÍQUIDA. Um aparelho e um
método para formar e encher simultaneamente um recipiente plástico é provido.
Uma cavidade de molde define uma superfície interna e é adaptado para aceitar
a pré-forma. Uma fonte de pressão inclui uma entrada e um dispositivo
semelhante a pistão. O dispositivo semelhante a pistão é móvel em uma
primeira direção, em que líquido é impelido para dentro da fonte de pressão
através da entrada e em uma segunda direção em que o líquido é expelido em
direção à pré-forma. Um bocal de sopro pode ser adaptado para receber liquido
da fonte de pressão e transferir liquido a uma alta pressão para a pré- forma,
impelindo a pré-forma a expandir em direção à superfície interna da cavidade
de molde e criar um recipiente resultante. O liquido permanece dentro do
recipiente como um produto final.
(71) Albemarle Corporation (US)
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 91
(72) James E. Torres, Alvin E. Harkins Jr., Thanikavelu Manimaran, B. Gary
Mackinnie
(74) Araripe & Associados
(85) 13/10/2008
(86) PCT US2007/066409 de 11/04/2007
(87) WO 2007/121228 de 25/10/2007
(21) PI 0710745-5 A2 (22) 17/04/2007
1.3
(30) 16/05/2006 DE 10 2006 022 801.4
(51) F02D 43/00 (2006.01), F02D 19/06 (2006.01)
(54) DISPOSITIVO E PROCESSO PARA O CONTROLE DE UMA MÁQUINA
DE COMBUSTÃO INTERNA
(57) DISPOSITIVO E PROCESSO PARA O CONTROLE DE UMA MÁQUINA
DE COMBUSTÃO INTERNA. A presente invenção refere-se a um dispositivo e
a um processo para o controle de uma máquina de combustão interna (1) que,
de modo opcional, pode ser operada com um combustível líquido ou com um
combustível em forma de gás. Para o combustível em forma de gás estão
previstas uma válvula redutora de pressão (4) e uma válvula de injeção de
baixa pressão (6). Além disso, estão previstos meios de supervisão que,
durante uma operação da máquina de combustão interna com o combustível
líquido, reconhecem um aumento de pressão acima de um valor limite, em
antes da válvula de injeção de baixa pressão (6), e para a redução da pressão
providenciam uma injeção do combustível em forma de gás.
(71) Robert Bosch GMBH (DE)
(72) Thorsten Allgeier, Winfried Langer, Juergen Foerster, Jens Thurso
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(85) 24/10/2008
(86) PCT EP2007/053711 de 17/04/2007
(87) WO 2007/131855 de 22/11/2007
(21) PI 0710760-9 A2 (22) 25/04/2007
1.3
(30) 26/04/2006 GB 0608262.2
(51) A61F 2/46 (2006.01), A61M 5/19 (2006.01)
(54) APARELHO DE FORNECIMENTO DE MATERIAL DE TRATAMENTO
MÉDICO
(57) APARELHO DE FORNECIMENTO DE MATERIAL DE TRATAMENTO
MEDICO Um aparelho de fornecimento (10) para fornecer material a um local
de tratamento médico o qual compreende uma pluralidade de recipientes (4)
para conter o material, uma saída de dispensa (6) e meio (2) para colocar cada
recipiente em comunicação com a saída e meio (16) para transferir material a
partir dos recipientes e através da saída. Os vários recipientes podem ser
montados de forma removível dentro de um cartucho removível. O aparelho é
arranjado de tal modo que o cartucho é propendido para seqúencialmente
mover cada um dos recipientes para comunicação com a saída. A saida pode
ser provida na extremidade de um bico de dispensa (8) onde o bico de dispensa
tem uma área em seção transversal interna que é uniforme e idêntica a dos
recipientes de modo que nenhum afilamento é provido quando o material é
dispensado a partir dos recipientes e para fora da saída.
(71) Summit Medical Limited (GB)
(72) David Foster
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT EP2007/003651 de 25/04/2007
(87) WO 2007/122006 de 01/11/2007
92
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) PI 0710761-7 A2 (22) 15/02/2007
1.3
(30) 25/04/2006 US 11/410.765
(51) B28C 5/42 (2006.01), B62D 49/08 (2006.01), B60P 3/16 (2006.01)
(54) ARRANJO PARA MELHORIA DA PERFORMANCE OPERACIONAL DE
UM CAMINHÃO MISTURADOR DE CIMENTO
(57) ARRANJO PARA MELHORIA DA PERFORMANCE OPERACIONAL DE
UM CAMINHAO MISTURADOR DE CIMENTO Um sistema (30) e um método
são providos para melhoria da performance operacional de um veículo
misturador de cimento em movimento (10) com um tambor de mistura rotativo
(20) pela parada automática da rotação do tambor de mistura em momentos
selecionados. O sistema pode incluir um sensor (40, 42, 44) adaptado para a
entrega de um sinal indicativo de um parâmetro operacional, tal como um
ângulo de direção do veículo, e uma unidade de processamento (46) adaptada
para receber o sinal a partir do sensor e entregar um sinal de controle com base
no sinal para parada da rotaçao do tambor de mistura.
(71) Bendix Commercial Vehicle Systems LLC (US)
(72) William P. Amato, Michael D. Tober, Timothy J. Frashure, Charles E. Ross
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT US2007/004093 de 15/02/2007
(87) WO 2007/123593 de 01/11/2007
(21) PI 0710762-5 A2 (22) 29/03/2007
1.3
(30) 27/04/2006 US 11/412.615
(51) H04B 1/16 (2006.01), G08C 17/00 (2006.01)
(54) MÉTODO E SISTEMA PARA MELHORAR A TRANSMISSÃO E A
RECEPÇÃO DE DESCRITORES DE CANAL
(57) METODO E SISTEMA PARA MELHORAR A TRANSMISSAO E A
RECEPÇAO DE DESCRITORES DE CANAL A invenção relaciona-se a um
método (200) e sistema para melhorar a transmissão ou a recepção de
descritoreS de canal. O método pode incluir as etapas de - em um sistema de
comunicação sem fio (100) que irradia periodicamente descritores de canal
regulares (310) a um intervalo fixado (312) - mudar (212) um esquema de
modulação e transmitir (216) um ou mais descritores de canal suplementares
(314) durante o intervalo fixado entre descritores de canal regulares. O método
também pode incluir a etapa de transmitir (214) periodicamente uma contagem
de descritor de canal (412) que fornece uma indicação do esquema de
modulação mudado.
(71) Motorola, INC. (US)
(72) Huai Y. Wang, Floyd D. Simpson
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT US2007/065411 de 29/03/2007
(87) WO 2007/127572 de 08/11/2007
RPI 2109 de 07/06/2011
(21) PI 0710763-3 A2 (22) 25/04/2007
1.3
(30) 25/04/2006 FR 0651464
(51) D03D 15/00 (2006.01)
(54) REVESTIMENTO PARA O SOLO
(57) REVESTIMENTO PARA O SOLO A presente invenção se refere a um
revestimento de solo provisório notadamente para o deslocamento sobre o solo
arenoso, lamacento ou pantanoso, comportando uma estrutura tecida formada
de fios de corrente (6) e de fios de trama (7) e cuja armação é tal que cada fio
de corrente (6) se entrecruze com os fios de trama (7) seguindo, de preferência
e muito aproximadamente, a metade das interseções das fileiras e colunas da
armação, esse fio de corrente (6) sendo deixado nas interseções restantes, de
modo, para cada fio de corrente (6), a obter pelo menos uma zona de armação
simples e apertada seguida de uma zona de ondulados, a alternância das
diferentes zonas mencionadas provocando apertos dos fios de trama (7) ,
criando um relevo importante do tecido assim realizado. De acordo com a
invenção, esse revestimento comporta fios planos (8) dispostos sobre pelo
menos uma parte da largura dessa estrutura tecida sobre pelo menos uma de
suas faces, cada um desses fios planos (8) sendo presos, regularmente ou não,
por fios de trama (7) colocados nas extremidades dos ressaltos dessa face da
estrutura tecida.
(71) Etablissements A. Deschamps Et Fils (FR)
(72) Georges-Paul Deschamps
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT EP2007/054078 de 25/04/2007
(87) WO 2007/122257 de 01/11/2007
(21) PI 0710764-1 A2 (22) 24/04/2007
1.3
(30) 27/04/2006 AT A 713/2006
(51) B29C 47/60 (2006.01), B29C 47/68 (2006.01), B29C 47/76 (2006.01)
(54) DISPOSITIVO DE EXTRUSÃO PARA DESGASEIFICAÇÃO E
FILTRAGEM DE MASSAS FUNDIDAS DE PLÁSTICO
(57)
DISPOSITIVO DE EXTRUSAO PARA DESGASEIFICAÇAO E
FILTRAGEM DE ASSAS FUNDIDAS DE PLASTICO invenção refere-se a um
dispositivo para extrusão de material sintético termoplástico, com uma espiral
de dispositivo de extrusão (2) montada em um alojamento (1), que abrange um
segmento de plastificação (P) do lado de afluxo, um segmento de
desgaseificação (E) a jusante de um segmento de descarga (A) e entre o
segmento de plastificação (P) e o segmento de desgaseificação (E) uma via de
transporte em sentido contrário (3), e com ao menos um canal de fluxo (5)
ponteando a via de transporte (3) em sentido contrário, contendo um filtro de
massa fundida (4) Para se prover condições de produção vantajosas, propõe-se
que a espiral do dispositivo de extrusão (2) forme entre a via de transporte (3)
em sentido contrário e a embocadura (6) do lado de saída do canal de fluxo (5)
uma via de transporte (7) no mesmo sentido e que o alojamento (1) na região
de passagem entre a via de transporte em sentido contrário e aquela no mesmo
sentido (3, 7) apresente ao menos uma abertura de desgaseificação (8)
(71) EREMA Engineering Recycling Maschinen und Anlagen Gesellschaft
m.b.H. (AT)
RPI 2109 de 07/06/2011
(72) Helmuth Schulz
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT AT2007/000185 de 24/04/2007
(87) WO 2007/124519 de 08/11/2007
(21) PI 0710765-0 A2 (22) 20/03/2007
1.3
(30) 25/04/2006 US 11/380.118
(51) G06F 15/16 (2006.01), G06F 21/00 (2006.01), G06F 9/32 (2006.01), H04L
9/00 (2006.01), H04K 1/00 (2006.01)
(54) MÉTODO E SISTEMA PARA A PROPAGAÇÃO DE DADOS DE
AUTENTICAÇÃO MÚTUA EM REDES DE COMUNICAÇÃO SEM FIO
(57)
MÉTODO E SISTEMA PARA A PROPAGAÇÃO DE DADOS DE
AUTENTICAÇÂO MUTUA EM REDES DE COMUNICAÇÂO SEM FIO Um
método e sistema para propagar dados de autenticação mútua tanto em uma
primeira rede de comunicação sem fio e uma segunda rede de comunicação
sem fio é útil para unificar redes de comunicação sem fio. O método inclui
autenticar mutuamente um primeiro nó que opera na primeira rede e um
segundo nó que opera na segunda rede (etapa 205). Uma mensagem de
unificação é então transmitida do primeiro nó para um terceiro nó que opera na
segunda rede, em que a mensagem de unificação indica que o primeiro nó é
autenticado com a segunda rede (etapa 210) Em resposta à mensagem de
unificação, mensagens de autenticação do terceiro nó e do segundo nó são
então repassados através do primeiro nó, para autenticar mutuamente o
terceiro nó e o segundo nó (etapa 215)
(71) Motorola, INC. (US)
(72) Anthony R. Metke, Donald E. Eastlake III, Zhi Fu
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT US2007/064390 de 20/03/2007
(87) WO 2007/127547 de 08/11/2007
(21) PI 0710766-8 A2 (22) 12/04/2007
1.3
(30) 27/04/2006 US 11/414.655
(51) G01R 15/18 (2006.01)
(54) INSTRUMENTO DE MEDIÇÃO ELÉTRICA QUE TEM UM GRUPO DE
CORRENTE DESTACÁVEL
(57) INSTRUMENTO DE MEDIÇAO ELÉTRICA QUE TEM UM GRAMPO DE
CORRENTE DESTACÁVEL Um medidor de grampo de corrente que tem um
corpo de medidor de corrente e um grampo de corrente destacável. O corpo de
medidor de corrente e o grampo de corrente são configurados de modo que o
grampo de corrente seja destacável do corpo de medidor de corrente e o
medidor seja operável com o grampo de corrente afixado ao corpo de medidor
de corrente ou destacado do corpo de medidor de corrente.
(71) Fluke Corporation (US)
(72) Shounan Luo, Wang Yong
(74) ORLANDO DE SOUZA
(85) 24/10/2008
(86) PCT US2007/066519 de 12/04/2007
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 93
(87) WO 2007/127617 de 08/11/2007
(21) PI 0710767-6 A2 (22) 24/04/2007
1.3
(30) 25/04/2006 US 60/794.702
(51) C07D 211/46 (2006.01), A61K 31/445 (2006.01), A61P 11/00 (2006.01)
(54) COMPOSTOS DE DIALQUILFENIL POSSUINDO ATIVIDADE AGONISTA
DE RECEPTOR B2-ADRENÉRGICO E ANTAGONISTA DE RECEPTOR
MUSCARÍNICO
(57) COMPOSTOS DE DIALQUILFENIL POSSUINDO ATIVIDADE AGONISTA
DE REPECTOR ß2-ADRENÉRGICO E ANTAGONISTA DE RECEPTOR
MUSCARINICO Esta invenção está relacionada a compostos da fórmula (I),
onde R1 e R2 estão conforme definido na especificação, ou um sal
farmaceuticamente aceitável ou um solvato ou estereoisômero deste. A
invenção também está relacionada a composições farmacêuticas e
combinações compreendendo tais compostos, processos e intermediários para
preparação de tais compostos, e métodos para utilização de tais compostos
para, por exemplo, tratar disfunções pulmonares, como doença pulmonar
obstrutiva crônica e asma.
(71) Theravance, INC. (US)
(72) Pierre-Jean Colson, Adam Hughes, Craig Husfeld, Mathai Mammen,
Miroslav Rapta
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT US2007/009925 de 24/04/2007
(87) WO 2007/127196 de 08/11/2007
(21) PI 0710768-4 A2 (22) 25/04/2007
1.3
(30) 26/04/2006 EP 06008600.6; 29/06/2006 EP 06013452.5
(51) B32B 15/14 (2006.01), F41H 5/04 (2006.01)
(54) ARTIGO COMPÓSITO, UM PROCESSO PARA SUA FABRICAÇÃO E
USO
(57) ARTIGO COMPÓSITO, UM PROCESSO PARA SUA FABRICAÇÃO E
USO A invenção se refere a um artigo compósito compreendendo uma folha de
metal de pelo menos 0,25 mm de espessura e pelo menos duas folhas
unidirecionais, com o metal na folha de metal possuindo um ponto de fusão de
pelo menos 350ºC, pelo que as folhas unidirecionais compreendem pelo menos
duas monocamadas de fibras de desempenho alto orientadas unidirecionais,
com a direção das fibras em uma monocamada estando em um ângulo a em
relação à direção das fibras em uma monocamada adjacente. A invenção se
refere, adicionalmente, a um processo para fabricação de um artigo compósito
e ao uso do artigo compósito nas edificações e construções, veículos e
aplicações de balística, especialmente sob condições de calor e fogo.
(71) DSM IP Assets B.V. (NL)
(72) Jean Hubert Marie Beugels, David Vanek, Johann Van Elburg, Alexander
Volker Peters, Steen Tanderup
(74) Orlando de Souza / OAB: 0474
(85) 24/10/2008
(86) PCT EP2007/003633 de 25/04/2007
(87) WO 2007/122000 de 01/11/2007
(21) PI 0710769-2 A2 (22) 15/02/2007
1.3
(30) 25/04/2006 CO 06-38720
(51) B09C 1/06 (2006.01), E21B 21/06 (2006.01), F26B 11/04 (2006.01)
(54) MELHORIAS EM UMA UNIDADE DE RECUPERAÇÃO DE
HIDROCARBONETOS TRANSPORTÁVEL
(57)
MELHORIAS EM UMA UNIDADE DE RECUPERAÇÂO DE
HIDROCARBONETOS TRANSPORTÁVEL Esta invenção se refere a melhorias
de uma unidade de recuperação de hidrocarbonetos transportável. Mais
particularmente, esta invenção se refere a uma unidade integral de recuperação
de hidrocarbonetos que compreende um primeiro sistema de evaporação e um
94
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
sistema de condensação. Da sua parte, o primeiro sistema de evaporação
compreende meios de alimentação do material objeto de extração que incluem
meios de controle de alimentação, meios de transporte do referido material,
meios de câmara de tratamento que incluem meios de limpeza interna, meios
de aquecimento do material, meios de incremento de área de transferência de
calor, meios de retirada do material remanescente que incluem meios de
incremento de impenetrabilidade e meios de transporte dos vapores extraídos
até o sistema de condensação. O objeto da invenção é proporcionar uma
unidade de extração de hidrocarbonetos e outros contaminantes do material
impregnado ao mesmo tempo em que proporciona, em menor tempo e maior
efetividade, o processo de recuperação.
(71) M-I Drilling Fluids International B.V. (NL)
(72) Servando Lozano
(74) Orlando De Souza / OAB: 0474
(85) 24/10/2008
(86) PCT IB2007/050889 de 15/02/2007
(87) WO 2007/122520 de 01/11/2007
(21) PI 0710770-6 A2 (22) 24/04/2007
1.3
(30) 24/04/2006 GB 0608055.0
(51) G02F 1/137 (2006.01)
(54) DISPOSITIVOS DE CRISTAL LÍQUIDO
(57)
MELHORIAS EM UMA UNIDADE DE RECUPERAÇÂO DE
HIDROCARBONETOS TRANSPORTÁVEL Esta invenção se refere a melhorias
de uma unidade de recuperação de hidrocarbonetos transportável. Mais
particularmente, esta invenção se refere a uma unidade integral de recuperação
de hidrocarbonetos que compreende um primeiro sistema de evaporação e um
sistema de condensação. Da sua parte, o primeiro sistema de evaporação
compreende meios de alimentação do material objeto de extração que incluem
meios de controle de alimentação, meios de transporte do referido material,
meios de câmara de tratamento que incluem meios de limpeza interna, meios
de aquecimento do material, meios de incremento de área de transferência de
calor, meios de retirada do material remanescente que incluem meios de
incremento de impenetrabilidade e meios de transporte dos vapores extraídos
até o sistema de condensação. O objeto da invenção é proporcionar uma
unidade de extração de hidrocarbonetos e outros contaminantes do material
impregnado ao mesmo tempo em que proporciona, em menor tempo e maior
efetividade, o processo de recuperação.
(71) Cambridge Enterprise Limited (GB)
(72) William Alden Crossland, Neil Collings, Paul Andrew Robertson
(74) Orlando De Souza
(85) 24/10/2008
(86) PCT GB2007/001488 de 24/04/2007
(87) WO 2007/122409 de 01/11/2007
(21) PI 0710771-4 A2 (22) 26/04/2007
1.3
(30) 26/04/2006 US 60/795.095
(51) C08L 23/20 (2006.01), C08J 5/18 (2006.01), B32B 27/32 (2006.01), B65D
30/14 (2006.01), C08L 23/06 (2006.01), C08L 23/08 (2006.01)
(54) PELÍCULAS DE POLIETILENO DE BAIXA DENSIDADE RESISTENTES
AO CRAQUEAMENTO POR FLEXÃO
(57) PELÍCULAS DE POLIETILENO DE BAIXA DENSIDADE RESISTENTES
AO CRAQUEAMENTO POR FLEXÃO Película de vedação para uso em uma
estrutura de película para a fabricação de bolsas e sacos para contenção de
materiais escoáveis, a película de vedação compreendendo 1) cerca de 2,0 a
cerca de 9,5% em peso, com base em 100% em peso da composição total de
um interpolimero de etileno C4-C10-alfa-olefina possuindo uma densidade de
0,850 a 0,890 g/cm3 e um índice de fusão de 0,3 a 5 g/10 minutos, o
interpolímero estando presente em uma quantidade, que otimiza a resistência
ao craqueamento por flexão, conforme medida usando um aparelho de teste de
Flexão Gelbo ajustado para teste de acordo com o ASTM F392, e minimiza a
redução da resistência térmica conforme medida usando DSC (ASTM
E794/E793) Calorimetria Diferencial de Varredura (DSC) que determina a
RPI 2109 de 07/06/2011
temperatura e fluxo de calor associados às transições de material como uma
função do tempo e da temperatura e rigidez da camada de película de vedação
conforme medido de acordo com o Método ASTM D882; 2) cerca de 70,5% em
peso a cerca de 98,0% em peso com base em 100% em peso da composição
total, de um ou mais polimeros selecionados dentre homopolímeros de etileno e
interpolímeros de etileno C4-C10-alfa-olefina, possuindo uma densidade entre
0,915 g/cm3 e 0,935 g/cm3 e um índice de fusão de 0,2 a 2 g/10 minutos; 3)
cerca de 0% em peso a cerca de 20,0% em peso com base em 100% em peso
da composição total de aditivos de processamento selecionados dentre agentes
de deslizamento, agentes antibloqueio, corantes e coadjuvantes de
processamento; e a película de vedação possui uma espessura de cerca de 2 a
cerca de 60 µm.
(71) Liqui-Box Canada INC (CA)
(72) Alan Keith Breck
(74) Orlando de Souza
(85) 24/10/2008
(86) PCT CA2007/000717 de 26/04/2007
(87) WO 2007/121590 de 01/11/2077
3. Publicação do Pedido
3.1
PUBLICAÇÃO DO PEDIDO DE PATENTE OU DE CERTIFICADO DE ADIÇÃO
DE INVENÇÃO
(21) MU 8801784-2 U2 (22) 29/05/2008
3.1
(51) A45C 1/04 (2006.01), A45C 11/24 (2006.01)
(54) CAPA PROTETORA DE APARELHO CELULAR, DOTADA DE SISTEMA
PRÁTICO DE ABERTURA E FECHAMENTO
(57) CAPA PROTETORA DE APARELHO CELULAR, DOTADA DE SISTEMA
PRATICO DE ABERTURA E FECHAMENTO. Trata-se o presente pedido de
modelo de utilidade a um aperfeiçoamento introduzido em uma capa (1) para
celular caracterizada essencialmente por revestir-se em couro sintético ou
couro natural macio, dotada de um cordão elástico (4), um passador (2) e um
terminal (3) que são pequenas peças de metais, responsáveis pela abertura e
fechamento da capa (1), e uma pequena abertura (5) por onde serão
introduzidos os respectivos aparelhos para dentro da capa (1), tal produto, tem
por escopo básico quanto ao seu aperfeiçoamento o sistema de fechamento
que é dotatdo de um cordão elástico (4) juntamente com o passador (2) e o
terminal (3), serão os principais responsáveis no processo de abertura da capa
(1), sendo a mesma fechada pelo mesmo cordão elástico (4), passador (2) e o
terminal (3), sendo que a função do passador (2) é de "correr" sobre o cordão
elástico (4), realizando o movimento de abertura e fechamento da capa (1), já a
função do terminal (3) é de evitar que o passador (2) se desprenda do cordão
elástico (4).
(71) Orlades Matos de Lima Neto (BR/PR)
(72) Orlades Matos de Lima Neto
(74) Carlos Eduardo Gomes da Silva
RPI 2109 de 07/06/2011
(21) MU 8801929-2 U2 (22) 25/09/2008
3.1
(51) A63B 49/00 (2006.01)
(54) RAQUETE ESPORTIVA DOTADA DE PRANCHA COM SISTEMAS DE
ENCAIXES PARA UM CABO ANATÔMICO E UM PRENDEDOR DE DEDOS
(57) RAQUETE ESPORTIVA DOTADA DE PRANCHA COM SISTEMAS DE
ENCAIXES PARA UM CABO ANATÔMICO E UM PRENDEDOR DE DEDOS,
refere-se o presente modelo ao campo técnico de materiais esportivos, mais
especificamente a uma raquete esportiva dotada de prancha com sistemas de
encaixes para um cabo anatômico e um prendedor de dedos, a qual foi
desenvolvida para facilitar a confecção das peças, melhorar o encaixe dos
componentes, deixar a face da batida da bola totalmente lisa e principalmente,
possibilitar a montagem de raquctes personalizadas, com combinações de
cores, cabos, prendedores de dedos e até mesmo, shapes diferenciados.
(71) Marcos Bonatto (BR/PR)
(72) Marcos Bonatto
(74) Douglas Hamilton de Queiroz
(21) MU 8801996-9 U2 (22) 15/09/2008
3.1
(51) A47K 7/02 (2006.01)
(54) DISPOSIÇÃO APLICADA EM ESPONJA PARA LIMPEZA
(57) DISPOSIÇÃO APLICADA EM ESPONJA PARA LIMPEZA composta
basicamente por um corpo (1) em material absorvente e/ou abrasivo que,
independente da forma, apresenta vazados (2) distribuidos ao longo do corpo
(1) propriamente dito, destinados a receber os dedos da mão do usuário,
promovendo a empunhadura ergonomicamente correta da esponja (3) inovada,
dessa maneira facilitando a limpeza.
(71) Pedro Silvério Pereira (BR/GO)
(72) Pedro Silvério Pereira
(74) Vilage Marcas & Patentes S/C Ltda
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 95
(21) MU 8802074-6 U2 (22) 15/09/2008
3.1
(51) A47J 41/02 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM BICO DE GARRAFA
TÉRMICA
(57) DISPOSIÇÃO CONSTRUTIVA APLICADA EM BICO DE GARRAFA
TÉRMICA. O presente modelo de utilidade refere-se a uma nova disposição
construtiva aplicada em bico de garrafa térmica, proporcionando maior conforto
e ergonomia ao usuário. O objetivo do presente modelo de utilidade da nova
disposição construtiva aplicada em bico de garrafa térmica, compreende um
bico (1) dotado de uma extremidade de articulação com forma aproximado de
uma esfera (2) abas laterais (3) para fixação junto a tampa (7). A esfera (2)
ilustra orifício posterior (4) que se comunica internamente com porção alongada
oca (5) preferencialmente retangular. Sobre a esfera (2) uma aba superior (6)
permite que se articule o bico proposto, sem a necessidade de contato manual
do usuário com a área de trânsito do liquido acondicionado na garrafa térmica,
proporcionando maior segurança, higiene e ergonomia ao produto.
(71) NSF Administração e Partcipações Ltda (BR/RS)
(72) Adelino Miotti
(74) Capella & Veloso Advogados Associados
(21) MU 8802081-9 U2 (22) 08/09/2008
3.1
(51) E21B 19/24 (2006.01)
(54) CENTRALIZADOR MECÂNICO
(57) CENTRALIZADOR MECÂNICO. O objetivo do presente pedido de modelo
de utilidade é fornecer um centralizador mecânico (1) em formato helicoidal, que
atuará como um bombeador e agitador de líquido.
(71) Higra Industrial Ltda (BR/RS)
(72) Silvino Geremia
(74) Guerra ADV.
96
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) MU 8802106-8 U2 (22) 11/09/2008
3.1
(51) F04D 1/04 (2006.01)
(54) BOMBA DE VORTEX PROGRESSIVA COM MOTOR SUBMERSO
(57) BOMBA DE VORTEX PROGRESSIVA COM MOTOR SUBMERSO. O
objetivo do presente modelo de utilidade é fornecer uma bomba de vortex
progressiva (11), acoplada diretamente através de seu eixo a um motor elétrico
submerso (12).
(71) Higra Industrial Ltda (BR/RS)
(72) Silvino Geremia
(74) Roner Guerra Fabris
(21) MU 8802125-4 U2 (22) 10/10/2008
3.1
(51) A01K 1/00 (2006.01), A01K 49/00 (2006.01)
(54) COLETOR DE PÓLEN
(57) 'COLETOR DE PÓLEN. O presente relatorio de modelo de utilidade
consiste num formato distinto de coletores de pólen acoplados na entrada de
colméias para abelhas constituindo a cobertura (1) produzida em material
isolante, a chapa com orificios (2) onde a abelha atravessando vai derrubar o
pólen que escoará até alcançar e ultrapassar a tela (3) empregada como
barreira, a segunda tela (4) com abertura menor pertencendo à gaveta lateral
(5), um suporte (6) fixado na extremidade da chapa com oritícios que, quando
puxado para o lado de tora juntamente com a chapa vai dispor de urna folga ou
espaço (7) evitando queda de destroços junto ao polen, saídas (8) nas laterais
para que as abelhas e zangões possam deslocar-se mais livremente e na parte
inferior uma terceira tela (9) evitando o contato do pólen com as abelhas pelo
fundo do coletor. Este tormato apresentado garante um acúmulo maior do
produto com alto grau de pureza além de agregar uma qualidade diterenciada
favorecendo tanto o produtor como os consumidores.
(71) Clodoaldo Proença da Silva (BR/PR)
(72) Clodoaldo Proença da Silva
(74) Marcos Antonio Nunes
RPI 2109 de 07/06/2011
(21) MU 8802138-6 U2 (22) 01/09/2008
3.1
(51) B68G 13/00 (2006.01), B68G 11/00 (2006.01), A47C 31/00 (2006.01),
A47C 27/00 (2006.01), A47C 23/34 (2006.01), A47C 20/02 (2006.01)
(54) COLCHÃO MODULAR
(57) COLCHÃO MODULAR. É descrito um colchão modular que provê a
integração de um ou mais módulos-base (10) com diferentes características de
materiais, revestimentos e densidade, apresentando, opcionalmente, pelo
menos um módulo de conforto (20) sobre o módulo-base (10), dito módulo de
conforto (20) com diferentes características de revestimento, densidade e
enchimento.
(71) Multispuma Industria e Comércio Ltda (BR/RS)
(72) Nilson Rech
(74) Mario de Almeida Marcas e Patente Ltda
(21) MU 8802745-7 U2 (22) 22/12/2008
3.1
(51) B60R 25/06 (2006.01)
(54) DISPOSIÇÃO APLICADA EM TRAVA ANTIFURTO PARA VEÍCULOS E
CONGÊNERES
(57) DISPOSIÇÃO APLICADA EM TRAVA ANTIFURTO PARA VEÍCULOS E
CONGÉNERES, que consiste de uma trava (1) a ser instalada no túnel (T) do
veículo na linha do trambulador (2) que acionada por controle remoto (não
representado) aciona um interruptor (3) que ativa um motor (4) e respectivo pino
(5) que faz batente em uma abraçadeira (6) devidamente posicionada no curso
da marcha à ré mantendo o câmbio (7) nessa posição, em paralelo atuando a
central de alarme (8) que corta a energia da bomba de combustível, entre
inúmeras outras funcionalidades inerentes ao alarme.
(71) Antonio Lopes (BR/SP)
(72) Antonio Lopes
(74) Vilage Marcas & Patentes S/S LTDA
RPI 2109 de 07/06/2011
(21) MU 8802756-2 U2 (22) 15/12/2008
3.1
(51) B65D 5/40 (2006.01)
(54) EMBALAGEM PARA BEBIDAS ENGARRAFADAS E/OU ENLATADAS
MULTIFUNCIONAL
(57) EMBALAGEM PARA BEBIDAS ENGARRAFADAS E/OU ENLATADAS
MULTIFUNCIONAL, especialmente de uma embalagem (1), em papelão com
revestimento a prova de umidade, de conformação preferencialmente tronco
piramidal quadrada que perfaz um volume interno ideal para receber garrafas
(2) ou latas de bebidas em geral que por suas particularidades possibilita a
colocação de gelo (3) juntamente com as garrafas (2) e/ou latas sendo uma
forma prática e versátil de manter ou gelar os produtos nela contidos, sendo a
mesma fabricada com matriz de corte e dobra que não geram emendas no seu
coro evitando qualquer tipo de vazamento.
(71) Gustavo Nogueira Sanches (BR/SP)
(72) Gustavo Nogueira Sanches
(74) Vilage Marcas & Patentes S/S Ltda
(21) MU 8802941-7 U2 (22) 11/12/2008
3.1
(51) A47B 83/02 (2006.01), A47B 85/04 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA EM CONJUNTO DE MESA E CADEIRA
(57) DISPOSIÇÃO CONSTRUTIVA EM CONJUNTO DE MESA E CADEIRA. É
descrita uma disposição construtiva em conjunto de mesa e cadeira que
compreende uma mesa com tampo (10) em formato qualquer e apoiado em pés
de apoio (II) e cadeiras dotadas de um assento (20), um encosto (21) que
acompanha o formato da borda do tampo (10) da mesa, pé traseiro (22) que
acompanham o formato do encosto (21), e pés frontais (23) que se projetam a
partir das laterais da face inferior do assento (20), dito encosto (21) da cadeira
apresentando altura igual ou menor que a distância do assento (20) ao tampo
(10) da mesa, com encosto (21) alinhado com o tampo (10) e pé traseiro (22)
alinhado com o pé de apoio (11) da mesa.
(71) Fabiano Olbrisch (BR/RS) , Tiago Zanotto (BR/RS)
(72) Fabiano Olbrisch, Tiago Zanotto
(74) Idea Marcas e Patentes Ltda
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 97
(21) MU 8802969-7 U2 (22) 17/12/2008
3.1
(51) A43B 9/00 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM CALÇADO
(57) DISPOSIÇÃO CONSTRUTIVA APLICADA EM CALÇADO. O presente
modelo de utilidade refere-se a uma nova disposição construtiva aplicada em
calçado, seja em couro, couro sintético capaz de oferecer ao produto um visual
mais delicado, copiando melhor sua forma e proporcionando maior resistência e
flexibilidade à região do bico. O objetivo do presente modelo de utilidade
compreende um cabedal (1) que recepciona um elemento (2) flexível e
resistente, sendo que na região plantar (3) é unido através da costura (4)
disposta na borda interna inferior (5), do cabedal (1), proporcionando maior
flexibilidade e conforto ao andar. Próximo ao bico (6), o elemento (2) é colado
ao cabedal (1) com um adesivo especial, proporcionando a rigidez necessária
para evitar o desgaste prematuro do bico do calçado ao andar. A seguir o
conjunto cabedal (1) e elemento (2) é anexado a palmilha % (7) para montagem
final do calçado, permitindo maior resistência e flexibilidade necessária ao
produto, preservando sua forma original.
(71) Calçados Ramarim Ltda. (BR/RS)
(72) Sergio Francisco da Silva
(74) Capella & Veloso Associados Ltda
(21) MU 8802990-5 U2 (22) 23/12/2008
3.1
(51) G08B 25/01 (2006.01), G08B 7/06 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM CENTRAL DE ALARME COM
PROGRAMAÇÃO ATRAVÉS DE TELEFONE COMUM OU CELULAR
(57) DISPOSIÇÃO INTRODUZIDA EM CENTRAL DE ALARME COM
PROGRAMAÇÃO ATRAVÉS DE TELEFONE COMUM OU CELULAR,
Compreende a presente patente de invenção a uma disposição introduzida em
central de alarme, que consiste na utilização das teclas de um telefone comum
ou de um telefone celular para sua programação, através de um circuito (1)
próprio contendo: módulo de detecção de rings (II) ou toques de telefone com
relé; microcontrolador (12); módulo de recepção de RING, DTMF (13) e outros
sinais gerados pela linha telefônica; módulo gerador de DTMF (14); fonte de
alimentação (15) estabilizada, regulada e que carrega a bateria; módulo para
acionamento dos relés de sirene (16); módulo com jumper RESET (17); módulo
MOD1 para dispositivos sem fio (18); módulo para leitura das Zonas (19) ou
setores do sistema de alarme. Sendo o circuito (1) acondicionado em uma
carcaça (2) contendo leds para sinalização de: rede (21); bateria (22); armado
(23); disc (24); e dois leds (25) que indicam apagados, que a zonal ou zona2
está desabilitada; acessos indica zona 1 ou zona 2 habilitada com sensores
fechados; piscando rápido indica que a zona 1 ou a zona 2 está habilitada, mas
com algum sensor aberto e piscando devagar indica que a zona 1 ou a zona 2
foi disparada. Contendo ainda um controle remoto (3) que permite armar ou
desarmar a central a distância, tendo três teclas (31) que podem ser
programadas para esta função, permitir habilitar e desabilitar zonas e acionar a
função pânico.
(71) JFL Equipamentos Eletrônicos - Ind. e Com. LTDA - ME (BR/MG)
(72) José Carlos Martins
(74) Marcos William Santos
98
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
centro da grelha (3) eleva-se um depósito (4) de combustível sólido. Uma
bandeja (5) é disposta ao lado da grelha (3) e destina-se a acolher as peças de
carne em preparação. O compartimento (1) apresenta uma abertura estreita
(11), que se estende por toda a sua frente, e alças laterais (12) para facilitar a
movimentação da churrasqueira. O depósito de combustível (4) é
paralelepipédico e possui a parede traseira fechada (41) e as laterais e frontal
gradeadas (42) para melhor distribuir o calor. A bandeja (5) é removível e
apresenta alças extremas (51).
(71) Marcos Kuhn (BR/RS)
(72) Marcos Kuhn
(74) Custódio de Almeida & Cia
(21) MU 8900274-1 U2 (22) 13/02/2009
3.1
(51) A47J 41/00 (2006.01)
(54) DISPOSIÇÃO EM BALDE DE GELO
(57) DISPOSIÇÃO EM BALDE DE GELO. O modelo de utilidade refere-se a
uma disposição construtiva introduzida em balde de gelo que torna esse
utensílio mais versátil. O balde de gelo é constituído de um recipiente externo
(1), de um recipiente interno (2) e de uma tampa (3). O recipiente interno (2) é
simplesmente apoiado no balde (1), permitindo o uso separadamente de cada
um deles. O recipiente externo (1) possui dois degraus internos (11) que são
resultantes dos achatamentos (12) de sua parede. O recipiente externo (1)
ainda possui duas alças planas (13) que se projetam ortogonalmente e que
apresentam a forma de meia-lua. O recipiente interno (2) possui uma borda
superior (21) e orifícios (22) em seu fundo (23). A tampa (3) do balde é plana e
possui dois rebaixamentos (31) que definem uma porção central saliente (32)
que atua como puxador. O correto posicionamento do recipiente interno (2) é
obtido pela borda superior (21) que se apóia nos degraus opostos (11) situados
no lado interno do balde (1). Desse modo, as paredes desses recipientes (1 e 2)
ficam suficientemente afastadas, gerando uma camada isolante de ar (4) entre
elas. Durante a manipulação da garrafa depositada no interior do balde, para
não molhar a toalha da mesa, a tampa (3) pode ser apoiada pelo seu puxador
(32) na borda do recipiente externo (1), ficando assim na posição vertical e
tangente a parede do balde.
(71) Juarez Vitório Martini (BR/RS)
(72) Juarez Vitório Martini
(74) Custódio de Almeida & Cia
(21) MU 8900350-0 U2 (22) 10/03/2009
3.1
(51) A47J 37/07 (2006.01)
(54) DISPOSIÇÃO EM CHURRASQUEIRA PARA PARRILLA
(57) DISPOSIÇÃO EM CHURRASQUEIRA PARA PARRILLA. O modelo de
utilidade refere-se a uma disposição construtiva introduzida em churrasqueira
destinada à preparação de "parrilla". A disposição em churrasqueira para
"parrilia" compreende um compartimento inferior raso (1) que é suportado pelos
pés (2), em cujas bordas está apoiada uma grelha superior e inclinada (3). No
(21) MU 8900395-0 U2 (22) 20/03/2009
3.1
(51) E03C 1/18 (2006.01)
(54) SISTEMA DE ESCOAMENTO PARA LAVANDERIA
(57) SISTEMA DE ESCOAMENTO PARA LAVANDERIA. A presente patente de
modelo de utilidade proporciona um sistema de escoamento da água que tende
a se acumular no sobreposto acoplado ao redor da cuba que dá origem ao
tanque de lavar roupas integrado em lavanderias consistindo na lavanderia (1)
composta por um tanque convencional (2), o tampo (3) sobreposto ao tanque
compreendendo estruturas elevadas (4) para acondicionar o sabão em barra, a
canaleta (5) circundando a cuba do tanque e se direcionando ao ponto de
coleta ou saida (6) por onde a água escoará a medida que é lançada sobre o
tampo. O ponto de coleta (6) é ligado diretamente à válvula do tanque (7)
através de um condutor (8) trabalhando de forma independente e realizando a
função continua, indiferente se a válvula do tanque esteja aberta ou fechada.
Vale enfatizar que a inovação apresenta um formato mais arrojado e moderno,
gera maior economia no emprego dos produtos de limpeza evitando maior
contato com a água e espaço mais amplo para o acondicionamento do sabão,
objetiva a retirada da água acumulada no sobreposto automaticamente evitando
assim que o piso torne-se escorregadio e causador de acidentes por
deslizamentos beneficiando principalmente seus usuários com maior segurança
e confiabilidade na rotina de trabalho.
(71) Gaam Indústria e Comércio de Móveis Ltda (BR/PR)
(72) Pedro Rodrigues da Silva
(74) Marcos Antonio Nunes
RPI 2109 de 07/06/2011
(21) MU 8900428-0 U2 (22) 13/03/2009
3.1
(51) B62D 49/06 (2006.01), B62D 53/02 (2006.01)
(54) TRACTOR RURAL COM CAÇAMBA E TRITURADOR
(57) TRACTOR RURAL COM CAÇAMBA E TRITURADOR o presente patente
de modelo de utilidade tem por objetivo uma máquina tracionadora (tractor ou
trator) sobre pneus, acionada por motor de combustão interna, com caçamba
para transporte e com triturador, ou outro implemento agrícola acoplado. O
trator é construído em cima do chassi metálico (04). O motor (01) transmite
energia mecânica para o acoplamento com tomada de força (05), que faz o
trator andar, e pode ser utilizado para acionar algum outro tipo de implemento
agrícola. Paralelamente, pode-se parar o trator e acionar o sistema de
acionamento do triturador (02), ao motor (01) para, como sugere o nome,
triturar algum material de origem vegetal. Material este que, após passar pelo
triturador é depositado na caçamba do trator (03), podendo-se, desta forma,
transportar-se mais material, pois o triturado ocupa menos espaço que o não
triturado.
(71) Hamilton Picolotto (BR/SC)
(72) Hamilton Picolotto
(74) Catiane Zini Borela
(21) MU 8900576-7 U2 (22) 16/04/2009
3.1
(51) B65H 75/06 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM CARTELA PARA ENROLAR TECIDOS
(57) DISPOSIÇÃO INTRODUZIDA EM CARTELA PARA ENROLAR TECIDOS.
Compreende a presente patente de modelo de utilidade a uma cartela para
enrolar tecidos aperfeiçoada, que oferece maior durabilidade, praticidade no
acondicionamento das peças de tecidos para venda no varejo, constituído por
um volume prísmático retangular, semelhante a uma bandeja invertida, formado
por uma lâmina de plástico ou metal (1), reciclável ou não, contendo bordas
dobradas em ângulo de 90º graus (2) e superfície superior formada por baixos
relevos lineares e paralelos (3) unidos medianamente por um baixo relevo linear
perpendicular (4) a eles, formando um volume rígido, leve, durável, imune a
umidade e não agrega peso, além de oferece menor dano por manuseio, sendo
produzida com materiais recicláveis e ser de fácil produção industrial.
(71) Walfrido Baião Pessoa (BR/MG)
(72) Walfrido Baião Pessoa
(74) Roberto Silva Fonseca - Lancaster
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 99
(21) MU 8900578-3 U2 (22) 01/04/2009
3.1
(51) A63B 7/00 (2006.01)
(54) APARELHO MULTIFUNCIONAL PARA PRÁTICA DE EXERCÍCIOS
FÍSICOS
(57) APARELHO MULTIFUNCIONAL PARA PRÁTICA DE EXERCÍCIOS
FÍSICOS. É descrito um aparelho multifuncional para prática de exercícios
físicos que compreende uma barra cilíndrica reta (10) que apresenta furos
passantes (11) dispostos na proximidade das extremidades; um par de barras
cilíndricas em formato parabólico (20) fixadas na barra cilíndrica reta (10), dito
par de barras cilíndricas parabólicas (20) que apresentam um primeiro furo
passante (21) posicionado contíguo à extremidade e um segundo furo passante
(22) disposto na proximidade da extremidade oposta, em ditos segundos furos
passantes (22) sendo inserido um meio de fixação (100) que une as barras
cilíndricas parabólicas (20) à barra cilíndrica reta (10); e uma barra de seção
quadrangular (30) dotada de furos passantes (31) contíguos às extremidades
fixada nas barras cilíndricas parabólicas (20) mediante inserçâo de um meio de
fixação (100) no primeiro furo passante (21) das barras cilíndricas parabólicas
(20) e no furo passante (31) da dita barra (30).
(71) Sérgio Roberto da Silva Rocha (BR/RS)
(72) Sérgio Roberto da Silva Rocha
(74) Patamar Assessoria Empresarial Ltda
(21) MU 8900612-7 U2 (22) 03/04/2009
3.1
(51) A61C 17/02 (2006.01), A61C 3/02 (2006.01)
(54) CONEXÃO PARA EVITAR ENTUPIMENTOS EM JATO DE
BICARBONATO
(57) CONEXÃO PARA EVITAR ENTUPIMENTOS EM JATO DE
BICARBONATO, graças ao sistema interno de conexão que minimiza o risco de
entupimento, não permitindo o acúmulo de bicarbonato umedecido dentro do
duto de ar. Compreende uma haste curvada (1) dotada de uma biqueira (2)
encapsulada que se apresenta dividida em um duto interno (12) por onde sai o
ar e outro duto, esse disposto ao redor (13) do primeiro, por onde sai a água,
sendo que referida haste curva é colada em duas regiões (4) em uma cabeça
troncônica (3); onde dita cabeça se assenta em uma peça intermediária (5),
dotada essa última de um conduto para o bicarbonato (6) e outro para a água
(7), concorrendo em separado e juntando-se na cabeça troncônica (3) por meio
de dutos internos (8); sendo que essa cabeça (3) se encaixa na peça
intermediária (5) por meio de conexões de vedação de segurança (9), vedação
da água (10) e vedação do ar (11).
(71) Fernando Luiz Cristofoli (BR/PR) , Flavio Augusto Bicalho Cristofoli
(BR/PR)
(72) Fernando Luiz Cristofoli, Flavio Augusto Bicalho Cristofoli
(74) Marpa Cons. e Asses. Empresarial Ltda
100
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) MU 8900620-8 U2 (22) 03/04/2009
3.1
(51) A61C 3/00 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA EM PRESSURIZADOR DE AR
(57) DISPOSIÇÃO CONSTRUTIVA EM PRESSURIZADOR DE AR para ser
acoplado em equipamentos odontológicos, empregados para auxiliar no
tratamento de remoção de tártaro por ultrasom piezo, placa bacteriana e
manchas intrínsecas pelo jato de bicarbonato para profilaxia dental. O
microcompressor (1) é composto por um propulsor de ar (10) e um motor
elétrico (11) que empurra o ar (5) pela saída (6) indicada no desenho com
pressão de até 14 lbs, circula pelo duto de ar até a conexão (7) com o
reservatório (3). O ar pressurizado dentro do reservatório (3) empurra o liquido
pela peneira (8), evitando que resíduos sólidos obstruam o duto de líquido, em
seguida pelos dutos (9), circula pelo pescador pela conexão do reservatório (7),
para dentro de um gabinete montado, até mesmo com outros produtos, em
seguida direcionado a peça de mão (4).
(71) Fernando Luiz Cristofoli (BR/PR) , Flavio Augusto Bicalho Cristofoli
(BR/PR)
(72) Fernando Luiz Cristofoli, Flavio Augusto Bicalho Cristofoli
(74) Marpa Cons. e Asses. Empresarial Ltda
(21) MU 8900628-3 U2 (22) 17/04/2009
3.1
(51) B60G 23/00 (2006.01), B60G 5/04 (2006.01), B62D 53/00 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM REBOQUE E SEMIREBOQUES
(57) DISPOSIÇÃO CONSTRUTIVA APLICADA EM REBOQUE E SEMIREBOQUES. É descrito um aperfeiçoamento em semi-reboque (100) que
apresenta na porção média do chassi um quarto eixo (11) distanciado dos
demais um a três eixos (10) convencionalmente dispostos no chassi, dito quarto
eixo (II) preferentemente de rodagem simples e/ou auto-direcional.
(71) Guerra S/A Implementos Rodoviários (BR/RS)
(72) Dirceo Sironi
(74) Mario de Almeida Marcas e Patente Ltda
(21) MU 8901967-9 U2 (22) 30/09/2009
3.1
(51) B03C 3/32 (2006.01), A61L 9/00 (2006.01)
(54) APERFEIÇOAMENTO INTRODUZIDO EM LAVADOR DE AR COM
ESCOAMENTO CONTRACORRENTE EM LÂMINAS INCLINADAS
(57) APERFEIÇOAMENTO INTRODUZIDO EM LAVADOR DE AR COM
ESCOAMENTO
CONTRACORRENTE
EM
LAMINAS
INCLINADAS,
pertencente ao campo dos equipamentos para tratamento de ar que é
constituída por recipiente de base ou reservatório (1) e tampa (2) dotada de
abertura posterior (3) com ventilador (não mostrado) localizado no interior de
uma estrutura de proteção (4) para sucção do ar ambiente, e de abertura frontal
(5) - que constitui orifício de saída do ar tratado - fechada por tela (6) ou
RPI 2109 de 07/06/2011
material similar. O recipiente de base (1) atuará como reservatório do fluido geralmente água - que proporcionará a limpeza e purificação do ar, e em seu
interior ficará localizada a bomba (7) que, por meio de um tubo (8), recalcará o
fluido até o topo das superfícies inclinadas (9.1, 9.2, 9.3 e 9.4) presas às
paredes laterais (10) da tampa (2). Pode ser dotado de uma única superfície
quadrangular (9.1) - da qual a lâmina de água retorna em forma de gotas ou
cortina para o reservatório (1) -, de duas superfícies quadrangulares (9.2)
sobrepostas - que proporcionarão duas lâminas com quedas livres para o
reservatório (1) -, de uma única superfície com borda inferior curva (9.3) para
submersão no fluido reservado - que elimina a existência de queda de água -,
com duas rampas contrapostas (9A) ou com outras quantidades de superfícies
dispostas de modos diversos.
(71) AQUAR CLIMATIZADORES LTDA ME (BR/SP)
(72) Antonio Carlos de Barros Neiva
(74) Pienegonda, Moreira & Associados Ltda.
(21) MU 8901968-7 U2 (22) 29/09/2009
3.1
(51) B60B 35/12 (2006.01)
(54) DISPOSIÇÃO APLICADA EM EIXO DO VIRABREQUIM
(57) DISPOSIÇÃO APLICADA EM EIXO DO VIRABREQUIM. Refere-se o
presente objeto a um inédito e funcional eixo do virabrequim (cambota), dividido
em quatro partes, encaixadas por estrias e rolamentos de agulha intercalados,
economizando no uso de matérias com maior vida útil do motor.
(71) EDUARDO DA CONCEIÇÃO SOUZA (BR/SP)
(72) EDUARDO DA CONCEIÇÃO SOUZA
(74) Ana Paula Mazzei dos Santos Leite
(21) MU 8901981-4 U2 (22) 30/09/2009
3.1
(51) G01D 5/34 (2006.01), G01B 11/26 (2006.01)
(54) POTENCIÔMETRO ÓPTICO
(57) POTENCIÔMETRO ÓPTICO. Patente de Modelo de Utilidade de um
potenciômetro que tem o objetivo de solucionar as falhas e ruídos dos
potenciômetros analógicos, causados pelo desgaste das pistas de material
resistivo devido ao movimento de um ou mais contatos diretamente sobre a
mesma. Para solucionar estes problemas foi desenvolvido o potenciômetro
óptico, objeto da presente patente o qual é constituído por um ou mais
emissores de luz (9) e (9A) (diodos emissores de luz, etc.), um ou mais
fotorreceptores (7) e (7A) (fotodiodos, etc.), e um ou mais variadores de
intensidade da luz (12) (que é um objeto que pode possuir várias formas e ser
construído por vários tipos de materiais) localizado entre o emissor e o receptor
de luz, sem contato mecânico com os mesmos, sendo o seu movimento
responsável pela quantidade de luz (8) e (8A) que incide no(s) fotorreceptor (es)
(7) e (7A) variando a (s) resistência ou nível de sinal na(s) saídas do
potenciômetro óptico (1 6),( 17) e (1 6A) e (17A) isento de falhas e
ruídos,devido ao fato de não haver desgaste das peças.
(71) LEANDRO PRIETO (BR/MG)
(72) LEANDRO PRIETO
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 101
refere-se a um elemento de conexão de tubulações em qualquer ramo de
atividade onde seja necessária a prolongação das mesmas, tais como em
equipamentos agrícolas, de limpeza ou outras, sendo caracterizada por ser
constituída por conector (1) cilíndrico, adaptador (2) superior, eixo dentado (3),
sistema de travamento (4), tampa (5) e maçaneta (6), sendo que o o conector
(1) cilíndrico possui um eixo dentado (3) posicionado longitudinalmente na alma
do mesmo e na sua parte superior, de forma solidária, um adaptador (2)
formado por anel bi-partido na sua parte frontal, e na parte posterior um semi
cilindro representando uma lingüeta. (7), e destacando que o sistema de
travamento (4) possui um corpo bipartido cuja fresta coincide com a abertura do
anel do adaptador superior que é solidário à parte superior frontal do conector
e, localizado no meio desta fresta está disposta uma chapa longitudinal (8)
provida de protuberância inferior (9) pelo lado interno, sendo que quando a
tampa (5) é fechada e travada pela maçaneta (6) a mesma é empurrada para
dentro do conector (1) fixando a tubulação ao mesmo.
(71) Cheng Mou Ching (BR/RJ)
(72) Cheng Mou Ching
(74) Luiz Roberto Longo Brito Silva
(21) MU 8901987-3 U2 (22) 30/09/2009
3.1
(51) A63C 17/01 (2006.01)
(54) DISPOSIÇÃO APLICADA A SKATE COM IMPULSÃO POR ESTEIRA
(57) DISPOSIÇÃO APLICADA A SKATE COM IMPULSÃO POR ESTEIRA
constituída por uma prancha de madeira (1) dotada de uma abertura central (2)
de acesso a uma esteira (3), com superfície externa ranhurada e largura
suficiente para acomodar os dois pés do usuário posicionados lado a lado,
colada a uma superfície dura (4) dotada de cerdas macias (5), que deslizam
sobre uma base fixa interna com superfície lisa e polida (6), sendo tal esteira (2)
associada a dois cilindros (7) providos de ranhuras iguais às da esteira (2), que
são rotacionados pela mesma e transmitem o movimento via polias (8) às rodas
(9) do equipamento.
(71) Lucas João Skowronski (BR/RS)
(72) Lucas João Skowronski
(74) D'Mark Registros de Marcas e Patentes S/C LTDA
(21) MU 8901991-1 U2 (22) 30/09/2009
3.1
(51) B65D 5/30 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM EMBALAGEM ALIMENTÍCIA
(57) DISPOSIÇÃO INTRODUZIDA EM EMBALAGEM ALIMENTÍCIA, idealizada
na forma de um invólucro descartável e higienizado, pertencente ao campo das
embalagens, de uso mais precisamente para o armazenamento, transporte e
disposição de alimentos prontos para entrega em domicílio ou para "consumo
em fast-foods", e ao qual foi dada original disposição construtiva, com vistas a
possibilitar a fabricação de uma embalagem na forma de recipiente troncoidal a
partir da dobradura de uma única peça de papel laminado e uma tampa.
(71) GUIDE FRANQUIAS LTDA (BR/SP)
(72) GUILHERME MINAMI
(74) Logos Marcas e Patentes S/C Ltda.
(21) MU 8901994-6 U2 (22) 30/09/2009
3.1
(51) F16L 1/26 (2006.01)
(54) DISPOSIÇÃO TÉCNICA INTRODUZIDA EM CONECTOR COM EIXO
PARA TUBULAÇÕES EM GERAL
(57) DISPOSIÇÃO TÉCNICA INTRODUZIDA EM CONECTOR COM EIXO
PARA TUBULAÇÕES EM GERAL. A presente Patente de Modelo de Utilidade
(21) MU 8901998-9 U2 (22) 30/09/2009
3.1
(51) A47G 19/03 (2006.01), A47G 23/06 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM BANDEJA-SUPORTE TRONCOIDAL
PARA APOIO DE ALIMENTOS E BEBIDAS
(57) DISPOSIÇÃO INTRODUZIDA EM BANDEJA-SUPORTE TRONCOIDAL
PARA APOIO DE ALIMENTOS E BEBIDAS, que trata de uma bandeja-suporte,
pertencente ao campo das embalagens, de uso mais precisamente para o apoio
e manipulação de invólucros de alimentos prontos, bebidas e pegadores do tipo
palito ou talheres, aplicáveis a alimentos prontos para entrega em domicílio ou
em "fast-foods", e ao qual foi dada original disposição construtiva, com vistas a
possibilitar o apoio de uma embalagem na forma de recipiente troncoidal e de
bebidas dispostas em copos ou latas, de forma a facilitar o transporte e
consumo de alimentos prontos.
(71) GUIDE FRANQUIAS LTDA (BR/SP)
(72) GUILHERME MINAMI
(74) Logos Marcas e Patentes S/C Ltda.
(21) MU 8902003-0 U2 (22) 29/09/2009
3.1
102
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(51) A21D 2/00 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM UNIDADE ITINERANTE PARA
FABRICAÇÃO DE FARINHA DE MANDIOCA
(57) DISPOSIÇÃO INTRODUZIDA EM UNIDADE ITINERANTE PARA
FABRICAÇÃO DE FARINHA DE MANDIOCA, compreendida por uma unidade
itinerante para fabricação de farinha de mandioca, pertencente ao campo dos
artigos da indústria alimentícia, constituída por uma plataforma sobre rodas (2)
contendo um elemento de reboque para atrelar aos veículos automotivos, sobre
o qual são instalados todos os aparatos necessários para a fabricação de
farinha de mandioca em todas as suas etapas, os quais são constituídos por:
um forno mecanizado para torragem de farinha, com pás giratórias (20)
acionado por um motor elétrico (9), acoplado a um motoredutor (19) embutido;
uma prensa (14) hidráulica com regulagem de altura, constituída a partir de um
tambor em aço inox, bem como um coletor de líquido também em chapa inox;
uma peneira elétrica (7); um ralador triturador de mandioca semi-automático e
um grupo gerador (10) de energia elétrica com motor a diesel de 6 CV, chave
liga/desliga individual, para a alimentação dos motores elétricos e quadro de
comando de entrada de energia elétrica do motor e rede elétrica.
(71) DANIEL FRUTUOSO NETO (BR/TO)
(72) DANIEL FRUTUOSO NETO
(74) José Bueno da Silva Filho
(21) MU 8902006-5 U2 (22) 29/09/2009
3.1
(51) A01K 13/00 (2006.01)
(54) PROTETOR DE OUVIDO CANINO
(57) PROTETOR DE OUVIDO CANINO. Compreendido por um aparelho de
silicone, macio e flexível, para ser colocado no ouvido externo do cão, pela (1)
borda superior arredondada, encaixada no (6) conduto vertical e (7) conduto
horizontal e a (3) base do protetor presa entre as curvas do (5) pavilhão
auricular do cão, posição e altura suficiente para não entrar água na (9)
membrana do tímpano do ouvido do cão, solucionando os inconvenientes
aventados, uma vez que a água proporciona a tão conhecida otite, pois o
protetor de ouvido canino é dotado de comprimento e curvatura adequada para
proporcionar o fechamento do (7) conduto vertical e (8) conduto horizontal do
cão, não comprometendo o ouvido do animal com mal cheiro e doenças.
Aparelho esse, que é adequado a anatomia do ouvido canino, oferecendo
conforto e comodidade no momento do banho e dos exercícios fisicos
aquáticos, possibilitando o melhor rendimento, pois não entrando água no (10)
ouvido externo do cão, o mesmo não fica irritado na hora do banho e dos
exercícios, evitando os transtornos que ocorrem constantemente nesses
momentos.
(71) Heloysa Feitosa da Silva Leitão (BR/RJ) , Luana Miceli Marques (BR/RJ)
(72) Heloysa Feitosa da Silva Leitão
(21) MU 8902166-5 U2 (22) 08/10/2009
3.1
(51) E04H 15/04 (2006.01)
(54) COBERTURA PORTÁTIL PARA PROTEÇÃO DE SOL E CHUVA PARA
VEÍCULOS
(57) COBERTURA PORTÁTIL PARA PROTEÇÃO DE SOL E CHUVA PARA
VEÍCULOS, refere-se a presente Patente de Modelo de Utilidade para uma
cobertura portátil para proteção do sol e chuva para veículos que é
compreendido por um toldo portátil na forma de membrana em filme polimérico
(1), estruturado com varetas de fibra plástica (2), ligadas a uma coluna espinhal
(5), com sistema telescópico (3), a cobertura de filme possui seis ventarolas (4),
tudo isso ligado a um pedestal (6), fabricado com conectores de forma
interconectáveis, que este ligado a uma base formada por dois tubos plásticos
telescópicos (7), ligados a duas chapas de fibra (8), ligados a uma peça
cilíndrica (9) e em cima a cobertura está ligada a um conector rotular (10) e
para melhor acomodação do equipamento existe uma área sanfonada (11) na
cobertura para facilitar a sua dobradura, assim como a existência de rótulas
(12) nas varetas estruturais.
(71) Jhonnys Tarquinio Marchiorato (BR/PR)
(72) Jhonnys Tarquinio Marchiorato
(21) MU 8902167-3 U2 (22) 08/10/2009
3.1
(51) B60T 15/00 (2006.01)
(54) MODIFICAÇÃO CONSTRUTIVA APLICADA EM VÁLVULA DE
RETENÇÃO
(57) MODIFICAÇÃO CONSTRUTIVA APLICADA EM VÁLVULA DE
RETENÇÃO, refere-se a modificações construtivas aplicadas em válvula de
retenção para cilindro, impulsor/mestre, de embreagem ou freio; PROBLEMA: o
problema apresentado pela configuração construtiva existente para válvulas de
retenção já conhecidas, está na utilização de flange localizado na parte frontal
do êmbolo, e no posicionamento da gaxeta e/ou anel O'ring que ficam alojados
no êmbolo da válvula; SOLUÇÃO PROPOSTA: presente relatório descreve
modificações que se caracteriza pelo fato da gaxeta(7) e o anel O'ring(3)
estarem posicionados de forma fixa em rebaixos dispostos, em posições
predefinidas, na parede interna da carcaça hidráuíica(1), e na eliminação do
flange.
(71) Zvonimir Raimundo Zupan (BR/SC)
(72) Zvonimir Raimundo Zupan
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 103
(74) Edemar Soares Antonini
(21) MU 8902169-0 U2 (22) 09/10/2009
3.1
(51) F21V 19/00 (2006.01)
(54) DISPOSIÇÕES INTRODUZIDAS EM PORTA LÂMPADAS DECORATIVO
COM RECEPTÁCULO DE PORCELANA E SIMILARES
(57) DISPOSIÇÕES INTRODUZIDAS EM PORTA LÂMPADAS DECORATIVO
COM RECEPTÁCULO DE PORCELANA E SIMILARES, compreendendo disco
(5), onde em sua base de diâmetro maior se projeta em sua circunferência
saliência semi-esférica (6) na face externa do mesmo, com ressalto (2) de
circunferência adequada formando corpo único, para alojar em seu interior o
receptáculo (1), cuja face de acabamento (10) de forma circular mostra no seu
perfil curvatura (9) pelo lado exterior e curvatura (4) no lado interno; furo (3) de
forma circular e profimdidade limitada, este por sua vez encontrando-se com o
furo (11) de forma circular, porém de circunferência menor,terminando na face
(10).
(71) Etore Fachini Filho (BR/SC)
(72) Etore Fachini Filho
(21) MU 8902172-0 U2 (22) 08/10/2009
3.1
(51) B60J 1/00 (2006.01), B60R 13/00 (2006.01)
(54) DISPOSITIVO ELETROMECÂNICO AUTOMÁTICO PARA ESTIRAMENTO
E DOBRADURA DE CORTINAS PARA CABINES, HABITÁCULOS,
COMPARTIMENTOS E AFINS
(57) DISPOSITIVO ELETROMECÂNICO AUTOMÁTICO PARA ESTIRAMENTO
E DOBRADURA DE CORTINAS PARA CABINES, HABITÁCULOS,
COMPARTIMENTOS E AFINS. Refere-se o presente modelo de utilidade a um
dispositivo eletromecânico para o estiramento e dobradura automáticos de
cortinas de materiais flexíveis para cabines, habitáculos, compartimentos e
afins, particularmente de veículos, embarcações e aeronaves, constituído de
uma unidade motriz (100), patins (200), cabo de tração (300) e trilho (400), que,
quando acionado remotamente pelo usuário, enrola o cabo de tração (300) por
um lado, desenrolando-o pelo outro, puxando um patim guia (202) ou (203) e a
cortina, havendo a dobradura da cortina e a conseqúente tração dos patins
escravos (201) até o acionamento do terminal fim de curso (106), sendo a
operação inversa possível para estirar a cortina. O presente modelo de utilidade
pertence ao campo da engenharia mecatrônica em acionamentos e
automatização de acessórios.
(71) José Henrique Skroch Andretta (BR/PR) , Elsio Luiz Andretta (BR/PR)
(72) José Henrique Skroch Andretta, Elsio Luiz Andretta
(74) Yuri Yacishin da Cunha
(21) MU 8902179-7 U2 (22) 08/10/2009
3.1
(51) G10C 9/00 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM TECLA DE PIANO
(57) DISPOSIÇÃO INTRODUZIDA EM TECLA DE PIANO. O presente pedido
refere-se a um dispositivo, para utilização em pianos verticais ou de cauda, que
permite ao técnico fazer o nivelamento da altura das teclas sem que o
mecanismo de um piano de cauda (ou as teclas, no caso de um piano vertical)
seja removido durante o procedimento.
(71) Djalma Pacheco de Carvalho Junior (BR/SP)
(72) Djalma Pacheco de Carvalho Junior
(74) CRUZEIRO NEWMARC PATENTES E MARCAS LTDA
(21) MU 8902213-0 U2 (22) 07/10/2009
3.1
(51) A47J 43/046 (2006.01), A47J 43/07 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM MEIO DE TRAVAMENTO E
LIBERAÇÃO ENTRE COPO E BASE DE LIQUIDIFICADOR/PROCESSADOR
(57) DISPOSIÇÃO INTRODUZIDA EM MEIO DE TRAVAMENTO E
LIBERAÇAO ENTRE COPO E BASE DE LIQUIDIFICADOR/PROCESSADOR.
O presente modelo revela uma disposição introduzida em liquidificador ou
processador, com um sistema de travamento e liberação do conjunto copo da
sua base. O mecanismo do presente modelo reage ao toque de um botão,
provido de mola de torção e trava, permitindo a remoção do conjunto copo da
base do mesmo. O presente modelo compreende um sistema de travamento e
liberação composto por um conjunto formado por um botão de acionamento (9),
pivotante ao redor de uma trava (12), por intermédio de seus eixos semicilíndricos (13), que se alojam no interior das sedes semi-cilíndricas (11) do
botão de acionamento (9). Entre o botão de acionamento (9) e a trava (12) é
posicionada uma mola de torção (23) , cuja porção superior tem perfil em forma
de "U" invertido e se aloja ao redor do corpo de trava (15) da trava (12) . Uma
vez acoplada a mola de torção (23) na trava (12), o corpo inferior (24) se apôía
nos ressaltos (17) do botão de acionamento (9), contra os quais fica comprimida
a mola de torção (23).
(71) GRUPO SEB DO BRASIL PRODUTOS DOMÉSTICOS LTDA. (BR/SP)
(72) Jose Carlos Veneziano, Angelo Wagner Merlo
(74) CRUZEIRO NEWMARC PATENTES E MARCAS LTDA
(21) MU 8902214-9 U2 (22) 07/10/2009
3.1
(51) A01F 29/00 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA INTRODUZIDA EM MÁQUINA
TRITURADORA DE MATERIAIS AGRÍCOLAS
(57) DISPOSIÇÃO CONSTRUTIVA INTRODUZIDA EM MÁQUINA
TRITURADORA DE MATERIAIS AGRICOLAS, prevê uma máquina (1)
fundamentalmente composta por uma estrutura de sustentação (2), um corpo
de contenção (3) e elementos internos; os elementos internos compreendem
basicamente: pelo menos uma peneira (5), pelo menos um elemento superior
de corte (6), pelo menos uma aresta cortante (7), pelo menos um disco divisor
(8), pelo menos um conjunto intermediário de corte (9), pelo menos um
elemento de arraste (10), e um eixo central (11); a peneira (5) trata-se de uma
peneira fixa de perímetro circular, e é composta por uma borda superior (5.1) e
por uma parede contornante (5.2), a qual apresenta pelo menos um rasgo (5.3);
o elemento superior de corte (6) compreende, fundamentalmente, uma régua
provida de múltiplos dentes dispostos lado a lado, em sentido horizontal; a
aresta cortante (7) trata-se de uma aresta preferencialmente triangular provida
de, no mínimo, um fio de corte; o disco divisor (8) compreende um disco circular
e plano; o conjunto intermediário de corte (9) é fundamentalmente composto por
múltiplas facas (9.1), por elementos espaçadores (9.2) e por um eixo cilíndrico
(9.3); o elemento de arraste (10) compreende um perfil em formato fundamental
de "L"; o eixo central (11) compreende um eixo cilíndrico provido de pelo menos
um flange (11.1).
104
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(71) AGROFORN IND. E COM. DE MÁQUINAS AGRÍCOLAS LTDA. (BR/SP)
(72) Luigi Fornoni
(74) Simbolo Marcas e Patentes Ltda
(21) MU 8902216-5 U2 (22) 07/10/2009
3.1
(51) B65D 5/22 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA INTRODUZIDA EM CAIXA PARA
TRANSPORTE E ACOMODAÇÃO DE ALIMENTOS EM GERAL
(57) DISPOSIÇÃO CONSTRUTIVA INTRODUZIDA EM CAIXA PARA
TRANSPORTE E ACOMODAÇÃO DE ALIMENTOS EM GERAL. Refere-se o
presente pedido de Patente de Modelo de Utilidade a disposição construtiva em
caixa para transporte de alimentos em geral. Mais especificamente refere-se à
caixa octogonal com corte e vincagem facilitadores de sua montagem e
desmontagem. O presente dispositivo é confeccionado de material derivado do
papel e constituído basicamente de uma base octogonal, sendo que em quatro
de suas intercessões, saem braços com vincagem em seu centro e em sua
base; possuem ainda um furo em sua base (na base octogonal), e uma
saliência retangular em sua extremidade superior; entre um braço e outro,
existe um hexágono irregular com três vincagens sendo uma em sua
intercessão com a base octogonal e as outras duas paralelas e perpendiculares
à base.
(71) Antonio Roque Garcia (BR/SP)
(72) Antonio Roque Garcia
(74) Beérre Assessoria Empresarial S/C Ltda
(21) MU 8902217-3 U2 (22) 06/10/2009
3.1
(51) G08B 7/00 (2006.01), G08B 3/00 (2006.01)
(54) SINALEIRO AUTOMÁTICO
(57) USINALEIRO AUTOMÁTICO constituído por uma base (1), uma haste (2),
aros (6), lentes (5), sistema de som e luz, interruptor (3) e auto-falante (4),
proporciona um novo conceito em sinalização por sua nova forma de
apresentação da base, da haste de sustentação, das lentes, do sistema de som
automático que permite a emissão do som programado antecipadamente para
ligar e desligar no horário desejado, e tendo ainda facilidade de instalação e
facilidade de fabricação, devido exatamente a essa nova concepção de
sinaleiro para garagens e outros estabelecimentos.
RPI 2109 de 07/06/2011
(71) Portas Incotel Ltda (BR/RJ)
(72) Alfredo Bertram Stenzel
(74) Renata dos Santos Pinheiro
(21) MU 8902218-1 U2 (22) 05/10/2009
3.1
(51) B65D 25/52 (2006.01), B65D 47/12 (2006.01)
(54) BICO DOSADOR DE LÍQUIDOS
(57) BICO DOSADOR DE LÍQUIDOS, particularmente de um bico dosador
destinado ao uso em máquinas automáticas enchedoras de produtos líquidos
como: cosméticos, farmacêuticos, lubrificantes, produtos de limpeza e similares,
destacando-se o modelo em questão por ser, quando comparado aos similares
do estado da técnica, de fácil desmontagem e fácil sanitização; consiste
essencialmente de um corpo monobloco (1) construído preferencialmente em
aço inoxidável AISI 316L, com conexão longa e curta (dependendo da versão
adotada), alternadas no conjunto, para fácil montagem e desmontagem das
mangueiras; sendo que ao referido corpo monobloco (1) se aplica a vareta
monobloco (2) construída preferencialmente em aço inoxidável AISI 316L, com
dupla vedação (3) e engate macho (4) do acoplamento rápido (A) conformado
na sua extremidade superior; inclui ainda o modelo um engate rápido fêmea (5),
que permite a saída lateral do engate macho (4), montado diretamente na rosca
do atuador pneumático (A1). Esta é a construção básica encontrada nas
versões aqui apresentadas, sendo que, apenas nas versões com fechamento
externo, é prevista, além dos componentes básicos acima, uma bucha plástica
bipartida (6), que possibilita a montagem, deslizamento e parada do sistema
deslizante.
(71) Natanael de Almeida (BR/SP)
(72) Natanael de Almeida
(74) Vilage Marcas & Patentes S/S Ltda
(21) MU 8902219-0 U2 (22) 05/10/2009
3.1
(51) B62D 63/08 (2006.01), B60D 1/06 (2006.01), B60R 9/00 (2006.01)
(54)
DISPOSIÇÃO
CONSTRUTIVA
INTRODUZIDA
EM
ENGATE
AUTOMÁTICO
(57)
DISPOSIÇÃO
CONSTRUTIVA
INTRODUZIDA
EM
ENGATE
AUTOMATICO. O presente modelo de utilidade refere-se a uma disposiçào
construtiva introduzida em engate automático utilizado em veículos rebocadores
e rebocados de uso rodoviário, misto ou tora de estrada, o qual compreende um
dispositivo de engate (1) aplicado a um ou mais reboques, através do qual um
pino vertical (18) e um garfo (4), dotado de buchas (9, 10) completamente
encaixadas na sua estrutura, trabalham para absorver os impactos durante o
deslocamento do veículo, conectando o veículo rebocador ao veículo rebocado.
(71) Jost Brasil Sistemas Automotivos Ltda (BR/RS)
(72) Diego Moro, Miguel Angelo Adami
(74) Vieira de Mello Advogados
RPI 2109 de 07/06/2011
(21) MU 8902220-3 U2 (22) 02/10/2009
3.1
(51) B63B 7/08 (2006.01)
(54) BOTE INFLÁVEL FLUTUANTE
(57) BOTE INFLÁVEL FLUTUANTE. Patente de Modelo de utilidade para um
bote inflável flutuante que é compreendido por 1, esqueleto de tubo oco na
forma decadeira 2, contendo seis furos nos tubos para junção dos mesmos 3,
tendo duas argolas conectadas ao tubo uma em cada lado para encaixe dos
remos 4, anexado ao tubo um reservatório pequeno em forma esférica para
conveniências 5, uma cadeira de fibra com quatro furos rio assento 6, suporte
para instalação do guarda-sol 7, ferro achatado para união por solda entre dois
tubos 8, espuma flutuante absorvente 9, bóia de borracha revestida com napa
resistente 10, corda de nylon para união da napa 11, terminal de borracha 12,
par de remos.
(71) Sergio Lopes da Rocha (BR/RJ)
(72) Sergio Lopes da Rocha
(21) MU 8902221-1 U2 (22) 01/10/2009
3.1
(51) A47F 5/08 (2006.01)
(54) DISPOSIÇÃO APLICADA EM MÃO-FRANCESA ENCAIXÁVEL EM
PRATELEIRA DE GÔNDOLAS DE SUPERMERCADOS E CONGÊNERES
(57) DISPOSIÇÃO APLICADA EM MÃO-FRANCESA ENCAIXÁVEL EM
PRATELEIRA DE GÔNDOLAS DE SUPERMERCADOS E CONGÊNERES
notadamente de uma mão-francesa (1) dotada de rasgos (2) compatíveis com
os entalhes (3) extremos, localizados nos reforços (4) das prateleiras (5) de
gôndolas (G) em geral, de forma a possibilitar fácil, prático e seguro encaixe,
entre dita mão-francesa (1) e respectiva prateleira (5), para tanto bastando
perfazer um simples giro entre as peças.
(71) N S F Indústria e Com de Equipamento P/Inst Com Ltda (BR/SP)
(72) Diniz Amilcar Matias Fernandes
(74) Vilage Marcas & Patentes S/S Ltda
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 105
(21) MU 8902222-0 U2 (22) 06/10/2009
3.1
(51) B44C 5/02 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA EM PERFIL TIPO MOLDURA
(57) DISPOSIÇÃO CONSTRUTIVA EM PERFIL TIPO MOLDURA, trata-se de
um modelo de utilidade referente à uma nova disposição construtiva em perfil
tipo moldura, o qual proporciona várias possibilidades para montagem de
quadros, caixas entre outros, com diversas combinações, apresentando
basicamente dois lados maiores paralelos entre si, e dois lados menores
paralelos entre si, e que são perpendiculares àqueles lados maiores, e dito que,
o primeiro lado maior apresenta uma face maior plana (F 1) a qual apresenta
em uma de suas extremidades uma saliência plana (S), enquanto que, o
segundo lado maior apresenta também uma face maior plana (F2), a qual
apresenta em ambos os extremos os rebaixos (Ri) e (R2), sendo cada um
desses rebaixos pertencentes também ao lado menor adjacente respectivo do
perfil.
(71) Industria de Molduras Moldurarte Ltda (BR/SC)
(72) Thaize Vanessa Costa
(74) Anel Marcas e Patentes Ltda
(21) MU 8902223-8 U2 (22) 06/10/2009
3.1
(51) A47B 91/02 (2006.01), A63D 15/00 (2006.01)
(54) PEÇA PARA NIVELAMENTO DE MESA DE BILHAR
(57) PEÇA PARA NIVELAMENTO DE MESA DE BILHAR compreendido por
uma peça que terá função de efetuar uma regulagem da altura dos pés de
mesas de bilhar. Este sistema de regulagem é fabricado a partir de uma base
(04) principal, que será a peça q terá contato com o chão, a esta peça é fixado
um parafuso (02), que será o responsável por erguer e abaixar a mesa. Para
uma melhor fixação do parafuso (02) as pernas (01) da mesa, o sistema possui
uma porca (03), que é fixada em uma chapa e parafusada na parte superior das
pernas (01) da mesa. Para efetuar a regulagem basta girar a base (04) do
sistema de nivelamento e o parafuso (02) que é fixado a ela fará o ajuste na
altura da mesa.
(71) Milton Moura Marchiori (BR/SC)
(72) Milton Moura Marchiori
(74) Catiane Zini Borela
106
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(21) MU 8902224-6 U2 (22) 06/10/2009
3.1
(51) B25B 11/00 (2006.01)
(54) HASTE ARTICULADA PARA APARELHO PEGA-VIDROS COM VENTOSA
(57) HASTE ARTICULADA PARA APARELHO PEGA-VIDROS COM
VENTOSA, trata-se de um modelo de utilidade referente ao aperfeiçoamento
introduzido em um aparelho dotado de ventosas, as quais são destinadas
principalmente à serem fixadas sobre vidros automotivos para seu transporte,
retirada ou fixação no veículo, sendo que o referido aparelho é constituído de
duas ventosas (V), já compreendidas no estado da técnica, as quais são cada
qual montadas num segmento de tubo (T1) e (T2), e sendo que ambos os tubos
têm suas extremidades opostas unidas articuladamente entre si por meio de um
parafuso dotado de manípulo (M), e sendo que num dos tubos ainda é montada
uma terceira ventosa simplificada auxiliar (S), a qual proporciona maior
segurança para a sucção do vidro, aumentando a eficiência do conjunto.
(71) Hamilton Souza Vieira (BR/SC)
(72) Hamilton Souza Vieira
(74) Anel Marcas e Patentes Ltda
(21) MU 8902226-2 U2 (22) 06/10/2009
3.1
(51) H05B 1/00 (2006.01), G05D 22/00 (2006.01), A45D 40/00 (2006.01)
(54) AQUECEDOR PARA ESPUMA DE BARBEAR
(57) AQUECEDOR PARA ESPUMA DE BARBEAR, trata-se de um modelo de
utilidade referente a um aparelho que é destinado a aquecer e ou manter
aquecida uma porção de espuma de barbear, mantendo-a numa temperatura
ideal e constante. Dito que, o referido aparelho ftmciona por meio de energia
elétrica, e é constituído basicamente de um recipiente superior (R), com formato
preferencial de meia-esfera, o qual é montado na extremidade superior de um
invólucro (1), com formato preferencialmente cilíndrico, e dito que sob o
recipiente superior (R) são estrategicamente montados recursos de resistência
elétrica (E) para aquecimento, possuindo botão de liga/desliga (B); termostato
(M); e opcionalmente um botão de ajuste de temperatura.
(71) Daniel Delfino (BR/SC)
(72) Daniel Delfino
(74) Anel Marcas e Patentes Ltda
RPI 2109 de 07/06/2011
(21) MU 8902227-0 U2 (22) 06/10/2009
3.1
(51) F16B 13/02 (2006.01), F16B 21/00 (2006.01)
(54) BUCHA DE EXPANSÃO TRI-PARTIDA PARA ALVENARIA EM GERAL
(57) BUCHA DE EXPANSÃO TRI-PARTIDA PARA ALVENARIA EM GERAL,
refere-se o presente modelo ao campo técnico de buchas de fixação em geral,
mais especificamente a urna bucha de expansão tri-partida para alvenaria em
geral, que proporciona a expansão para três lados consecutivamente,
melhorando a instalação e fixação de parafusos, ganchos ou escapulas, e
consequentemente a sustentação de móveis e objetos.
(71) Alberto Mauricio Haschich Jonke (BR/PR)
(72) Alberto Mauricio Haschich Jonke
(74) Fernando José Carvalho
(21) MU 8902228-9 U2 (22) 07/10/2009
3.1
(51) F25D 3/02 (2006.01), A47B 73/00 (2006.01)
(54) DISPOSIÇÃO TÉCNICA INTRODUZIDA EM GELADEIRAS E FREEZERS
(57) DISPOSIÇÃO TÉCNICA INTRODUZIDA EM GELADEIRAS E FREEZERS.
A presente Patente de Modelo de Utilidade diz respeito a Disposição Técnica
Introduzida em Geladeiras e Freezers, (1), caracterizada pela utilização de
formatos diversos tais como latas de refrigerantes (2), garrafas (3), copo (4) e
outros, os quais são aplicados em qualquer um destes equipamentos
eletrodomésticos, permitindo personalizar os mesmos e facilitando seu uso a
nível comercial em eventos e promoções.
(71) Claudio Roberto do Nascimento Nobrega (BR/SP)
(72) Claudio Roberto do Nascimento Nobrega
(74) Marcelo Henrique Zanoni
RPI 2109 de 07/06/2011
(21) MU 8902229-7 U2 (22) 07/10/2009
3.1
(51) A47B 23/02 (2006.01)
(54) CABECEIRA DE CAMA COM CRIADO-MUDO EMBUTIDO
(57) CABECEIRA DE CAMA COM CRIADO-MUDO EMBUTIDO,
compreendendo um pequeno móvel que fica embutido dentro da cabeceira de
uma cama, que pode ser puxado para fora como se fosse uma gaveta,
consistindo-se em um elemento auxiliar que ao ser puxado se posiciona ao lado
da cabeceira.
(71) José Schuvartz (BR/RS)
(72) José Schuvartz
(74) Norberto Pardelhas de Barcellos
(21) MU 8902230-0 U2 (22) 07/10/2009
3.1
(51) B62K 5/04 (2006.01)
(54) CONSTRUTIVIDADE APLICADA EM CHASSI PAR TRICICLO
MOTORIZADO
(57) CONSTRUTIVIDADE APLICADA EM CHASSI PARA TRICICLO
MOTORIZADO, compreendendo um chassi que se pode acoplar em uma
motocicleta, de modo a transformá-la em um triciclo de carga, sendo essa
montagem realizada de modo rápido e eficiente, além de contar com a
reversibilidade do processo. Essa construtividade forma um kit combinado de
quatro partes atuando em conjunto para ser aplicado em uma motocicleta, onde
as partes são: chassi da balança (12), chassi de carga (13), chassi central (14)
e sistema de freio (15).
(71) Targos Equipamentos e Veículos Ltda. (BR/RS)
(72) MARCELO DOS REIS SALDANHA
(74) Marcas Brazil Marcas e Patentes Ltda
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 107
(21) MU 8902256-4 U2 (22) 01/10/2009
3.1
(51) B22C 9/00 (2006.01)
(54) ALIMENTADOR DE ALTO DESEMPENHO PARA USO EM FUNDIÇÃO E
PRODUÇÃO DE PEÇAS METÁLICAS
(57) ALIMENTADOR DE ALTO DESEMPENHO PARA USO EM FUNDIÇÃO E
PRODUÇÃO DE PEÇAS METÁLICAS. A presente Patente de Modelo de
Utilidade de um alimentador de alto desempenho para uso em fundição e
produção de peças metálicas tem por finalidade reduzir o volume de metal
contido nos massalotes existentes no mercado, resultando em um aumento no
rendimento metálico do processo de fundição, através das variações
geométricas e dimensionais internas e externas introduzidas nos aumentadores
ou luvas. O dito alimentador (1) de alto desempenho é envolto pelo massalote
(2) e mantém o metal (4) em seu interior envolvendo-o em contato direto com
toda a superficie do mesmo, exceto na base (5) desse metal (4). Tal
alimentador (1) é dotado do dispositivo denominado macho de Willians (3),
localizado em seu eixo de simetria, e possui um volume no mínimo três vezes
maior em relação ao volume do metal (4). Deste modo, pode-se concluir que a
racionalidade aplicada no referido aumentador proporciona vantagens múltiplas,
atingindo o equilíbrio necessário entre a qualidade das peças produzidas, a
economia no sistema de produção, a versatilidade e o alto rendimento obtido no
processo de fundição.
(71) ISOTEC INDUSTRIA E COM PRODS PARA METALURGIA LTDA (BR/SP)
(72) ALTINO RIBEIRO DA SILVA JÚNIOR
(74) Beérre Assessoria Empresarial S/C Ltda
(21) MU 8902258-0 U2 (22) 01/10/2009
3.1
(51) E05C 3/04 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM FECHO
(57) DISPOSIÇAO INTRODUZIDA EM FECHO. Descreve-se uma disposição
introduzida em fecho (10) dotado de uma base (3) provido em alumínio em
formato de "u" que serve como elemento de fixação para a maçaneta (1) de
alumínio de acionamento. A base (3) possui uma capa externa (2) que envolve
todo seu corpo, em plástico para conferir acabamento e para limitar o
movimento da maçaneta (1), absorvendo também o desgaste entre as duas
peças.
(71) Papaiz-Udinese Metais Indústria e Comércio Ltda (BR/SP)
(72) Paolo Papaiz
(74) CRUZEIRO NEWMARC PATENTES E MARCAS LTDA
(21) MU 8902259-9 U2 (22) 01/10/2009
(51) A61M 11/00 (2006.01)
3.1
108
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(54) DISPOSITIVO QUE PERMITE REALIZAR AEROSOL DE SOLUÇÕES
(57) DISPOSITIVO QUE PERMITE REALIZAR AEROSOL DE SOLUÇÕES
Patente de modelo de utilidade é composto por haste de polietileno, oca
apresenta dispersor em uma extremidade e um conector na outra, o que
oermite a dispersão de substâncias líquidas na foirma de aerosol aumentando,
assim, a superficie de contato entre o líquido e o tecido vivo. Por ser uma
modificação que incorpora leveza, uso único, permite o fácil manuseio, fácil
esterilização, fácil direcionamento do líquido ao local que se deseja tratar, por
apresentar baixo custo e alta eficiência, aumentará o uso, por profissionais da
área da saúde, desta forma de colocar em contato substâncias e tecidos vivos
(dispersão/aerosol/spray) Incorporados à tal modificação estão maior
resolutividade e biosegurança para os pacientes em questão.
(71) LUIZ ALEXANDRE LORICO TISSIANI (BR/SP)
(72) LUIZ ALEXANDRE LORICO TISSIANI
(21) MU 8902260-2 U2 (22) 02/10/2009
3.1
(51) A47J 37/07 (2006.01)
(54) CHURASQUEIRA PARA ASSAR CARNES NA BRASA DE CARVÃO
(57) CHURRASQUEIRA PARA ASSAR CARNES NA BRASA DE CARVÃO.
Patente de Modeio de Utiiidade para uma eburrasqueira de assar carnes na
brasa de carvão e compreendida por uma caixa porta carvão 17, fechada
lateralmente a direta 4, fechada lateralmente a esquerda 3, grelha soldada
traseira 1, grelha soldada frontal 2, base com tudo soldada para os pés 5,
gaveta porta cinza lateral 6, gavetas porta gordura frontal e traseira 7, reforços
Jateraís interno 8, tampa da caixa porta carvão 9, suporte da alça para
transporte 10, cabo de madeira da alça de transporte 11, cabo de madeira da
tampa superiorl2, pés da churrasqueira 13, cravada bucha m8 14, parafuso m8
15, arruelas de pressão m8 16, canaletas para os espetos 18.
(71) METALURGICA ZONI LTDA ME (BR/SP)
(72) JOSÉ SANTOS DA SILVA
(21) MU 8902261-0 U2 (22) 02/10/2009
3.1
(51) F23G 5/40 (2006.01), B65F 7/00 (2006.01)
(54) DISPOSIÇÃO TÉCNICA INTRODUZIDA EM PROCESSADOR DE LIXO
GASOGÊNICO MÓVEL
(57) DISPOSIÇÃO TECNICA INTRODUZIDA EM PROCESSADOR DE LIXO
GASOGÊNICO MÓVEL. O presente Modelo de Utilidade diz respeito à
Disposição Técnica Introduzida em Processador de Lixo Gasogênico Móvet(1),
caracterizada por ser constituida por forno reator (2); duto de entrada!
transporte de lixo (3); motor hidráulico principal (4) do forno reator (2); motor
hidráulico de acionamento do deslocamento do lixo (5); compressor de alta
pressão (6); reservatórios de gasogênio, (7) para pressões de 200bar; lavador
(8) de gasogênio; caçambas receptoras de lixo/recepção (9); motor hidráulico
(lO) de acionamento do transportador de lixo; bomba hidráulica central (11);
reservatório regenerador do óleo hidráulico (12); revestimento térmico refratário
(13) do forno reator (2); eixo principal eletromagnético (14); Bobinas
eletromagnéticas (15); Entrada de lixo (16) para o forno reator (2); saida (17) de
cinzas, metais, vidros, etc.; reservatório (18) de cinzas, metais, etc.; expurgo
(19) das cinzas, metais, vidros, acionado por motor hidráulico; parafuso
transportador (20) do lixo; Interior do forno (21), no qual é processada a queima
anaeróbica do lixo; anel (22) em forma de mola com a dupla função de limpeza
e transporte de cinzas, metais, vidros, etc.; orificio (23), no qual é coletado o
gasogênio; motor hidráulico expurgador (24); motor hidráulico (25) do
compressor de alta pressão (6).
(71) DAUNAR MAZZONI CAMPOS (BR/SP) , VAGNER ALVES CARDOSO
(BR/SP) , RONALDO PERISSOTO DA SILVA (BR/SP)
(72) DAUNAR MAZZONI CAMPOS, VAGNER ALVES CARDOSO, RONALDO
PERISSOTO DA SILVA
(74) Marco Antonio de Oliveira
(21) MU 8902263-7 U2 (22) 02/10/2009
3.1
RPI 2109 de 07/06/2011
(51) E03B 9/20 (2006.01), B67D 3/00 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM BEBEDOURO
(57) DISPOSIÇÃO INTRODUZIDA EM BEBEDOURO, sendo que o bebedouro
em questão é indicado pela referência numérica (1) e incorpora um espaço
interior (3), passível de ser ocupado por um recipiente (4) produzido em argila
queimada, dito recipiente (4) recebe a conexão de uma torneira (5), que
traspassa a abertura (6) provida na parede frontal (7) do gabinete (2) e é
conectada diretamente a um orifício de montagem (8) previsto na porção inferior
da parede contornante (9) do recipiente (4); o gabinete (2) incorpora sobre si
uma projeção anelar (10) que estabelece a acomodação entre o referido
gabinete (2) e um garrafão de água mineral padrão (11), o qual é posicionado
com seu gargalo (12) devidamente voltado para baixo; o gabinete (2) apresenta
uma proeminência inferior (13), a qual centralmente conta com uma área
nivelada (14) que acomoda uma peça coletora de pingos (15), a qual é passível
de receber uma gravação (16) aplicada em sua superfície (17).
(71) INACIO TRISTÃO DA SILVEIRA CAMPOS (BR/SP) , DIANA DOS
SANTOS RIBEIRO (BR/SP) , SEBASTIÃO FATOBENE (BR/SP)
(72) DIANA DOS SANTOS RIBEIRO, INACIO TRISTÃO DA SILVEIRA
CAMPOS, SEBASTIÃO FATOBENE
(74) Magister Marcas E Patentes S\C Ltda
(21) MU 8902270-0 U2 (22) 01/10/2009
3.1
(51) A47J 37/07 (2006.01)
(54) CHURRASQUEIRA A ÁLCOOL
(57) CHURRAQUEIRA A ÁLCOOL. O presente pedido de patente de modelo de
utilidade refere-se a uma churrasqueira para assar qualquer tipo de carne ou
esquentar alguma panela, leve, prática e de simples manuseio, que por utilizar
álcool combustível como elemento de combustão, não produz fumaça,
possibilitando a sua utilização em qualquer lugar. A CHURRASQUEIRA A
ÁLCCOL é simples, leve, pratica, rápida e não poluente, que utiliza álcool
combustível como elemento de brasa, não produz fumaça ou sujeira e pode ser
utilizada em qualquer lugar. A CHURRASQUEIRÃ A ÁLCOOL é composta por
um Suporte em Cavalete (1) e uma Base de Apoio (2) que funcionam como
suporte para o Gabinete dos Fogareiros (3) através dos pés de apoio (4). No
interior do Gabinete encontram-se os Reservatórios de Álcool (5), os
Abafadores para controle de Chama (6) e o suporte para reservatório de
gordura, óleo e outros (7), oriundos do furo de chapa (12). Para facilitar o
transporte o gabinete conta com duas alças de apoio (8). A CHURRASQUEIRA
A ÁLCOOL conta ainda com o Gradil (9) e a Chapa (10) com alças de apoio
(11).
(71) Julio Cesar Neves Panao (BR/PR)
(72) Julio Cesar Neves Panao, Alexandre Andreatta
(74) Alexandre Pietrângelo Lima
RPI 2109 de 07/06/2011
(21) MU 8902271-8 U2 (22) 02/10/2009
3.1
(51) G09D 3/04 (2006.01), B43M 99/00 (2010.01)
(54) CONJUNTO PLÁSTICO JARRA-CALENDÁRIO PERMANENTE COM
PORTA-CANETAS E PORTA-CARTÕES DE VISITA
(57) CONJUNTO PLÁSTICO JARRA-CALENDÁRIO PERMANENTE COM
PORTA-CANETAS E PORTA-CARTÕES DE VISITA. O Conjunto Plástico
Jarra-Calendário Permanente com Porta-Canetas e Porta-Cartões de Visita,
que em apenas um objeto conjuga os itens Utilidade, ornamentação,
Informação, Auto-Ajuda e descontração, proporcionando assim uma
combinação de praticidade e melhora psicológica para o lar ou ambiente de
trabalho. O dito Conjunto é constituido de uma base ratangular (8.3), a partir da
qual estão afixados um cilindro central (2) ladeado por dois cilindros menores
(8.1 e 8.2), sendo que a peça do centro (2) constitui-se no Primeiro Cilindro da
Jarra, que tem dentro de si outros quatro cilindros giratórios independentes (3,
4, 5 e 6), que comporão assim o mecanismo do Calendário Permanente e das
outras informações e fotos.
(71) Marco Antônio Germano de Moraes (BR/MG)
(72) Marco Antônio Germano de Moraes
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 109
(21) MU 8902273-4 U2 (22) 01/10/2009
3.1
(51) F02M 63/00 (2006.01)
(54) KIT SOS PARA BOMBAS E BICOS INJETORES
(57) APERFEIÇOAMENTO INTRODUZIDO EM ESCOVA DENTAL conformando uma escova dental modulável (1) para limpeza dos dentes e
higienização bucal, dotada de haste e cabeça com tufos de cerdas,
consubstanciando cabeça removível (2) em forma de cabeça de serpente, com
tufos de cerdas (3) ordenados estrategicamente de modo a conformar duas
fileiras perimetrais (4) intercaladas por uma fileira mediana (5), dita cabeça (2)
definindo um pescoço prolongado (6) do qual sobressai um trecho mediano (7)
em forma de "S", para fixação na extremidade de engate (8) da haste (9), sendo
que a referida haste configura um corpo ergonômico definindo projeções
laterais (10) de curvas suaves (11), com leve concavidade (12) no trecho
central, separadas ainda por uma abertura vazada longitudinal (13), seguindo
os mesmos padrões suaves de contorno.
(71) Jose Cicero dos Santos (BR/PR)
(72) Jose Cicero dos Santos
(74) Alexandre Pietrângelo Lima
(21) MU 8902274-2 U2 (22) 02/10/2009
3.1
(51) F24C 15/10 (2006.01)
(54) CHAPA COM GRADES EMBUTIDAS PARA FOGÃO A GÁS
(57) CHAPA COM GRADES EMBUTIDAS PARA FOGÃO A GÁS, refere-se o
presente modelo ao campo técnico de acessórios para fogões em geral, mais
especificamente a uma chapa com grades embutidas para fogão a gás, que
oferece as opções de preparo tradicional dos alimentos, através da disposição
direta das panelas sobre as grades e chamas do fogão, ou o preparo ou
aquecimento dos alimentos, através da disposição das panelas sobre a chapa
aquecida.
(71) Eolita Inês Fortkamp (BR/PR) , Antonio Kramer Rocha (BR/PR)
(72) Eolita Inês Fortkamp, Antonio Kramer Rocha
(74) Yuri Yacishin da Cunha
(21) MU 8902272-6 U2 (22) 01/10/2009
3.1
(51) A46B 15/00 (2006.01), A46B 9/04 (2006.01)
(54) APERFEIÇOAMENTO INTRODUZIDO EM ESCOVA DENTAL
(57) APERFEIÇOAMENTO INTRODUZIDO EM ESCOVA DENTAL conformando uma escova dental modulável (1) para limpeza dos dentes e
higienização bucal, dotada de haste e cabeça com tufos de cerdas,
consubstanciando cabeça removível (2) em forma de cabeça de serpente, com
tufos de cerdas (3) ordenados estrategicamente de modo a conformar duas
fileiras perimetrais (4) intercaladas por uma fileira mediana (5), dita cabeça (2)
definindo um pescoço prolongado (6) do qual sobressai um trecho mediano (7)
em forma de "S", para fixação na extremidade de engate (8) da haste (9), sendo
que a referida haste configura um corpo ergonômico definindo projeções
laterais (10) de curvas suaves (11), com leve concavidade (12) no trecho
central, separadas ainda por uma abertura vazada longitudinal (13), seguindo
os mesmos padrões suaves de contorno.
(71) Carlos Ferreira da Silva (BR/PR)
(72) Carlos Ferreira da Silva
(21) MU 8902277-7 U2 (22) 01/10/2009
3.1
(51) B65D 85/36 (2006.01), B65D 81/133 (2006.01)
(54) EMBALAGEM COM LACRE PARA LANCHES QUE SE TRANSFORMA
EM BANDEJA
110
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(57) EMBALAGEM COM LACRE PARA LANCHES QUE SE TRANSFORMA
EM BANDEJA, trata-se de uma embalagem confeccionada com sistema de
corte e vinco sem qualquer tipo de colagem ou adesivo, produzida em papel
cartão, micro-ondulados e ondulados, com revestimentos ou sem, em
gramaturas diversas para acondicionamento de lanches, com fechamento por
meio de lacres que impedem a violação após colocação do produto,
transformando-se, com sua abertura e destaque, em uma bandeja feita com
vincos e dobraduras para utilização imediata.
(71) Jorge Vanderlei Nunes Teixeira (BR/RS)
(72) Jorge Vanderlei Nunes Teixeira
(21) MU 8902280-7 U2 (22) 02/10/2009
3.1
(51) E04G 9/02 (2006.01)
(54) BARROTEAMENTO METÁLICO PARA EXECUÇÃO DE LAJE MACIÇA
OU NERVURADA COM FÔRMA PLÁSTICA
(57) BARROTEAMENTO METALICO PARA EXECUÇÃO DE LAJE MACIÇA
OU NERVURADA COM FÔRMA PLÁSTICA. O presente modelo é um
barroteamento metálico apoiado em escoras metálicas telescópicas (5) para
execução de laje maciça ou nervurada com fôrma plástica (6), composto por
módulos variáveis de barrotes reguláveis (2 e 3) com travamento nos dois
sentidos do plano de laje e com detalhes em madeira (18) para que o
compensado (9) da laje (tablado) possa ser pregado. A modulação é definida
pelo tamanho dos elementos da fôrma plástica (6) ou do compensado (9). O
modelo admite variações de distância (C2 e C3) entre os eixos nos dois
sentidos do plano de laje, executando lajes nervuradas com qualquer tamanho
e forma (quadrado ou retangular) do elemento de enchimento (fôrma plástica)
existente no mercado (previsto pela NBr 6118) ou lajes maciças, sendo o
tablado formado por qualquer tamanho de placa de compensado existente no
mercado. Com um mesmo barroteamento metálico poderemos executar
qualquer tipo de laje maciça, nervurada ou nervurada com trechos maciços,
com uma pequena variação de tipos de peças (barrotes). A fôrma plástica (6)
apóia diretamente sobre o barroteamento (1) e (2 e 3) e no restante do plano de
laje onde ela não cobre, que são os trechos de laje maciça, é feita a colocação
do compensado pregado diretamente nos barrotes. Após a concretagem e a
cura do concreto, o barroteamento metálico será retirado para execução de
uma nova laje sem qualquer desperdício de material. Na desforma, o
compensado (9) do tablado e a fôrma plástica (6) serão retirados para nova
reutiuização. Por ser formada de peças leves e curtas necessita de apenas uma
pessoa para carregar, sendo o transporte vertical feito pelo próprio elevador de
obra.
(71) Paulo César Cardoso (BR/GO)
(72) Paulo César Cardoso
(21) MU 8902286-6 U2 (22) 02/10/2009
3.1
(51) B23F 21/03 (2006.01), A61B 17/16 (2006.01)
(54) TRITURADOR DE OSSOS PARA ENXERTO BUCAL COM FUROS
PARALELOS INCLINADOS
(57) TRITURADOR DE 0SS0S PARA ENXERTO BUCAL COM FUROS
PARALELOS INCLINADOS. Tratou a presente solicitação de modelo de
utilidade, a um novo triturador de ossos, que tem como novidade inventiva à
inclinação vertical dos furos acompanhados dos sulcos, que formam um
desenho levemente espiral, desenvolvido especialmente para raspar ossos. E
ter como resultado desta operação, um pó relativamente fino e homogêneo em
sua granulometria, sem travamentos ou entupimentos. Sendo compreendido
por um corpo (1) monobloco com tambor (2), provido de furos (3) circulares e
levemente inclinados para fora do centro do oco interno (9), alinhados
horizontalmente em colunas (11) em forma de espiral, com rebaixo (4) de
formação das lâminas (10).
(71) Antonio Wiggers (BR/SC)
(72) Antonio Wiggers
(74) Sandro Conrado da Silva
(21) MU 8902288-2 U2 (22) 02/10/2009
3.1
(51) B62D 63/06 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA EM CARRETINHA DE TRANSPORTE
(57) PATENTE DE MODELO DE UTILIDADE DE DISPOSIÇÃO
CONSTRUTIVA EM CARRETINHA DE TRANSPORTE, formada por um chassi
central(2), que possui, na sua porção anterior, articulaçáo(3) com o braço(4), o
qual na sua extremidade oposta faz o engate da carretinha(1) com o veículo
automotor preferido A porção posterior do dito chassi central(2) possui
articulação com o chassi prolongado móvel(5), o qual possibilita o procedimento
de dobrar a parte traseira a carretinha(1) quando de seu armazenamento ou
guarda do implemento veicular, acarretando na substancial redução de
comprimento e volume da carretínha(1), podendo passar por aberturas de
portas de tamanhos padrões 2mts x 0,8mts Ainda na porção posterior do dito
chassi central(2) tem-se suportes transversais(6), os quais são compostos por
rodinhas ou similares(7), de modo aos ditos suportes(6) sustentarem a
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 111
carretinha(1) e, as rodinhas(7) possibilitarem seu deslocamento ou arraste,
quando a dita carretinha(1) estiver disposta em pé.
(71) Apoitec do Brasil Comércio de Equipamentos Industriais Ltda Me (BR/SC)
(72) Leila Regina Serpa Gomes
(74) Sandro Wunderlich
(21) MU 8902291-2 U2 (22) 02/10/2009
3.1
(51) F16B 2/00 (2006.01), F16B 7/00 (2006.01)
(54) UNIÃO PARA HASTES BIPARTIDAS
(57) UNIÃO PARA HASTES BIPARTIDAS, formada por duas peças simétricas
auto-encaixáveis, que internamente possuem um rebaixo(2), preferencialmente
semi-esférico, que apresenta em um de seus lados, projeção cilíndrica(3) e no
outro lado, furo vazado(4), sendo que, a porção cilíndrica(3) transpassa os
furos(5) existentes nas hastes bipartídas(6) cada porção lateral longitudinal
apresenta um ressalto(7) e um rebaixo(8), de forma aos mesmos se encaixarem
quando as partes são fechadas sobre os diâmetros das hastes bipartidas(6), as
quais, preferivelmente, podem apresentar pontas tipo macho-fêmea(9).
(71) Luiz Alberto Saad (BR/SC)
(72) Luiz Alberto Saad
(74) Sandro Wunderlich
(21) MU 8902292-0 U2 (22) 05/10/2009
3.1
(51) E03D 1/22 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM CAIXA DE DESCARGA
PARA VASO SANITÁRIO
(57) DISPOSIÇÃO CONTRUTIVA APLICADA EM CAIXA DE DESCARGA
PARA VASO SANITÁRIO, compreendendo um reservatório que contém uma
divisão interna (3) que o separa em dois compartimentos, um contendo volume
reduzido de água para descarga de dejetos líquidos e outro para descarga de
dejetos sólidos; sendo que esses dois compartimentos de descarga apresentam
sistemas de acionamento independentes (10 e 11), meio comunicante (16)
entre os dois e ladrão (19 e 20).
(71) Luiz Carlos Martins Silva (BR/RS)
(72) Luiz Carlos Martins Silva
(21) MU 8902293-9 U2 (22) 01/10/2009
3.1
(51) A61C 13/08 (2006.01), A61C 13/38 (2006.01)
(54) APERFEIÇOAMENTO NO PROCESSO DE SELEÇÃO DENTÁRIA E
SISTEMA DE RETENÇÃO DE FACETAS EM ESCALA PARA ESCOLHA DA
FORMA E TAMANHO DE DENTES A SEREM UTILIZADOS EM
REABILITAÇÃO ORAL
(57) APERFEIÇOAMENTO NO PROCESSO DE SELEÇÃO DENTÁRIA E
SISTEMA DE RETENÇÃO DE FACETAS EM ESCALA PARA ESCOLHA DA
FORMA E TAMANHO DE DENTES A SEREM UTILIZADOS EM
REABILITAÇAO ORAL composto por um conjunto de facetas unidas por
sistema de união para escolha de dentes, contando com o acréscimo de
reentrâncias (1) na face posterior das facetas exceto na região central destas, a
qual será mantida no mesmo nível da face posterior da faceta e a qual receberá
uma perfuração horizontal (2) que irá permitir a passagem do componente
flexivel (4) que une as facetas entre si, formando os conjuntos de dentes,
observa-se ainda a presença de emergencias (3) que permitem a fixação
destas a um rolete ou lâmina de cêra para a que a simulação dos resultados
finais seja obtida, com o processo de escolha ocorrendo diretamente em boca e
com a participação do paciente do paciente.
(71) Ruy Teichert Filho (BR/RS)
(72) Ruy Teichert Filho
(21) MU 8902313-7 U2 (22) 02/10/2009
3.1
(51) G02B 27/24 (2006.01), A47F 3/00 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA INTRODUZIDA EM DISPLAY PARA
PROJEÇÃO DE IMAGENS EM TRÊS DIMENSÕES
(57) DISPOSIÇÁO CONSTRUTIVA INTRODUZIDA EM DISPLAY PARA
PROJEÇAO DE IMAGENS EM TRES DIMENSÕES. A presente patente de
modelo de utilidade refere-se a uma disposição construtiva introduzida em
display (ou mostrador) para projeção de imagens em três dimensões, destinado
ao uso publicitário em pontos de venda, que simula holografia por meio da
utilização de técnica em espelho, promovendo no consumidor uma sensação de
visualização de uma holografia.
(71) PRIMECOMM COMUNICAÇÃO LTDA. (BR/SP)
(72) ORLANDO CAMPOS DE ANDRADE NETO
(74) IDEIATIVA PROPRIEDADE INTELECTUAL LTDA.
(21) MU 8902433-8 U2 (22) 07/10/2009
3.1
(51) A45C 11/04 (2006.01)
(54) DISPOSIÇÃO APLICADA EM ESTOJO PARA ÓCULOS E ELEMENTO DE
LIGAÇÃO PIVOTANTE INJETADOS
(57) DISPOSIÇÃO APLICADA EM ESTOJO PARÁ ÓCULOS E ELEMENTO DE
LIGAÇÃO PIVOTANTE INJETADOS, consiste essencialmente de um estojo (1)
para óculos, fabricado em polietileno ou material maleável compatível, que se
destaca pela tampa (2), base (3), casulo (C) e elemento (4) de ligação pivotante
serem obtidos em etapa única, sendo dito elemento (4) derivado do próprio
material utilizado na injeção.
(71) Odiwaldo Bosco Filho (BR/SP)
112
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(72) Odiwaldo Bosco Filho, Daniel Bosco
(74) Vilage Marcas & Patentes S/S Ltda
(21) MU 8902449-4 U2 (22) 01/10/2009
3.1
(51) H05B 33/02 (2006.01), H01L 27/15 (2006.01)
(54) LÂMPADA DE CIRCUITO IMPRESSO DE LEDs (RÉGUA) COMPATÍVEL
COM SOQUETES PARA LÂMPADAS FLUORESCENTES
(57) LÂMPADA DE CIRCUITO IMPRESSO DE LEDs (REGUA) COMPATÍVEL
COM SOQUETES PARA LÂMPADAS FLUORESCENTES. Uma "Lâmpada de
circuito impresso de LEDS(Régua) compatível com soquetes para lâmpadas
fluoreseentes" inclui, um jogo de carcaça e lente a serem instalados em
ambientes domésticos. O Jogo de carcaça e lente são montados a sobre uma
placa de circuito impresso, instaladas de forma hermética (uma sobre as outra)
ambas de formato semi tubular. Ambas as peças (carcaça e lente), tem por
finalidade as seguintes missões. A primeira promover um intercambio padrão de
lâmpadas de circuitos impressos (régua) de LEDs com soquetes universal de
lâmpadas tluorescentes. A segunda acondicionar e isolar os circuitos
eletrônicos de lâmpadas de circuito impresso com LEDs do meio exterior (Fig3).
Corno complemento ambas as peças que compõe o conjunto serão unidas
através de dois bocais universal de lâmpada fluorescentes.
(71) ELIAS GOMES DE LIMA (BR/SP)
(72) ELIAS GOMES DE LIMA
(21) MU 8902453-2 U2 (22) 07/10/2009
3.1
(51) B60B 30/08 (2006.01), B60B 19/00 (2006.01)
(54) CINTO PROTETOR DE RODAS DE VEÍCULOS
(57) CINTO PROTETOR DE RODAS DE VEICULOS. Que poderá ser instalado,
de forma ajustada, em qualquer tipo de roda de veículo, para que, em situações
de perda de pressão do pneu ou mesmo quando do seu total esvaziamento, o
veículo possa continuar trafegando, sem prejuízo do seu desempenho ou danos
funcionais, tanto da roda quanto do pneu.
(66) MU8802226-9 07/10/2008
(71) Alberto Alexandre Cruz (BR/SP)
(72) Alberto Alexandre Cruz
(74) David Nilton Pereira de Lucena
RPI 2109 de 07/06/2011
(21) MU 8902458-3 U2 (22) 10/10/2009
3.1
(51) A47B 43/00 (2006.01)
(54) CONFIGURAÇÃO CONSTRUTIVA APLICADA EM ESTANTE
(57) CONFIGURAÇÃO CONSTRUTIVA APLICADA EM ESTANTE, refere-se a
uma estante diferenciada aliando estilo e funcionalidade de móvel retangular de
três compartimentos verticais 2 (dois) laterais, prateleiras formatadas por
compartimentos laterais, ao centro formata-se por gavetas e compartimento
utilitário, dispõe de duas portas deslizantes frontais.
(71) Anivaldo Aparecido Borsari (BR/PR)
(72) Anivaldo Aparecido Borsari
(21) MU 8902460-5 U2 (22) 01/10/2009
3.1
(51) E04D 1/06 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM TELHAS CERÂMICAS
(57) DISPOSIÇÃO CONSTRUTIVA APLICADA EM TELHAS CERÂMICAS. A
presente Patente de Modelo de Utilidade refere-se a um inovador modelo de
telhas cerâmica do tipo "capa e canal" dotado de desenho próprio que
proporciona melhor encaixe entre telhas, melhor vedação e melhor resistência
mecânica. A presente invenção é constituída de uma parte plana horizontal(1)
ligada por um traçado longitudinalmente inclinado a uma parte abaulada semicilindrica(2); provida um reentrância retangular(3) em uma das quinas e de
outra reentrância(4), esta alongada, na quina diametralmente oposta; dotada,
em sua face superior, de uma barreira envoltória em "L"(5) em uma das laterais
ladeada paralelamente por uma segunda barreira em "L"(6), menor e provida de
rasgos de escoamento(7) e, em sua face inferior, de uma barreira reta
transversal(8) junto à face frontal, paralela a duas outras barreiras retas
transversais(9), de cinco outras barreiras paralelas retas transversais
menores(10) regularmente distribuídas e de dois calços quadrados(11) junto à
face traseira.
(71) Mario Jacob Yunes Junior (BR/MG) , Adão Hercilio Pereira (BR/SC) ,
Moysés Sidney Sacagni (BR/SP)
(72) Mario Jacob Yunes Junior, Moysés Sidney Sacagni, Adão Hercilio Pereira
(74) Cidwan Uberlândia Ltda
(21) MU 8902630-6 U2 (22) 08/10/2009
3.1
(51) H01H 36/00 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM SENSOR DE FIM-DE-CURSO
(57) DISPOSIÇÃO INTRODUZIDA EM SENSOR DE FIM-DE-CURSO. Trata-se
de uma disposição em sensor para ser utilizada em mecanismos responsáveis
pelo funcionamento de máquinas no setor industrial, constituindo-se de haste
(1), suporte da haste (2), rótula (3), caixa (4), tampa (5), prensa cabo (9),
membrana de borracha (10), eixo (11).
(71) Sulmaq Industrial e Comercial S.A (BR/RS)
(72) Rael Ângelo Larini
(74) Lealvi Marcas e Patentes Ltda
RPI 2109 de 07/06/2011
(21) MU 8902738-8 U2 (22) 02/10/2009
3.1
(51) A01M 7/00 (2006.01)
(54) PULVERIZADOR COM PRESSURIZAÇÃO PARA APLICAÇÃO DE
CARRAPATICIDAS E HERBICIDAS
(57) PULVERIZADOR COM PRESSURIZAÇÃO PARA A PLICAÇÃO DE
CARRAPATICIDAS E HERBUGIDAS. O pulverizador com pressurização para
aphcação de carrapaticidas e herbicidas, que montado em um gabinete conjuga
as funções de pulvenzar e misturar os produtos a serem aplicados,
proporcionando economia e perfeita homogeneização dos produtos contidos no
reservatório. O dito pulverizador é constituído por uma moto-bomba de
pressurização (4) reservatório de produtos (19) mangueiras (16) e bicos para
jatos de pulverização com registro incorporado à lança para corte de fluxo (17),
possui ainda chave liga desliga (26) para colocar em funcionamento e parar a
moto-bomba quando se desejar e rodas fixadas no gabinete para deslocamento
(29).
(71) Ildeu Pimenta do Amaral (BR/MG)
(72) Ildeu Pimenta do Amaral
(21) MU 8902754-0 U2 (22) 09/10/2009
3.1
(51) B60R 13/00 (2006.01)
(54) PROTETOR DE LATARIAS E ASPECTO VISUAL PARA SER
UTILIZADOS EM VEICULOS
(57) PROTETOR DE LATARIAS E ASPECTO VISUAL PARA SER
UTILIZADOS EM VEíCULOS, compreendendo em um protetor contra riscos e
amassamento de latarias de veículos automotores, proporcionando um aspecto
visual para divulgação de material publicitário, composto de (1) Placa protetora,
proteger a pintura de um veiculo ou eletrodoméstico contra riscos, (2)
Reentrância da placa protetora, para absolvição de impacto, (3) ímãs, para
fixação na lataria de um veiculo, Também compreendendo um protetor contra
riscos e amassamento de latarias de veículos automotores que poderá ser
acrescentado outros componentes variáveis como, (4) Ventosas para fixação na
lataria de um veiculo, (5) Corda para sustentação do varão, (6) Varão, para
fixação da placa protetora.
(71) GUY FRAGATA MARTINS DE BARROS (BR/SP) , JOÃO MANUEL
MORAIS NETO (BR/SP)
(72) GUY FRAGATA MARTINS DE BARROS, JOÃO MANUEL MORAIS NETO
(74) Scorpions Marcas e Patentes S/C Ltda.
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 113
(21) MU 8902777-9 U2 (22) 01/10/2009
3.1
(51) A01C 7/08 (2006.01)
(54) DISTRIBUIDOR DE SEMENTES E INSUMOS AUTOPROPELIDO
(57) DISTRIBUIDOR DE SEMENTES E INSUMOS AUTOPROPELIDO é um
Modelo de utilidade da transformação de um trator convencional utilizado na
área agrícola em um distribuidor de sementes e insumos autopropelido, sendo a
mescla de um trator agrícola com um implemento, tendo como resultado o
distribuidor, que consiste em utilizar um trator agrícola com tração nas quatro
rodas em um distribuidor conforme descrito anteriormente. Nesse processo, o
trator tem a parte de acento, direção, pedais, indicadores e elementos originais
necessários á utilização do trator transferidos para uma cabine de pilotagem
nova a ser instalada onde os citados e outros elementos indispensáveis á
operação e controle do mesmo são instalados, além de permitir acessórios para
tomar o trabalho mais seguro, agradável e confortável. O motor caixa de
transmissão e diferencial e eixo dianteiro e de transmissão do mesmo são
mantidos originais. São acrescentados elementos estruturais para alongar o
trator e permitir que esse tenha instalado a sua estrutura a cabine e o novo
implemento, passando esse veículo a ter uma aplicação única e específica que
é a utilização do mesmo para ser um distribuidor de sementes e insumos, a
lanço.
(71) Carmetal Ind e Com de Implementos Rodoviarios Ltda (BR/RS)
(72) Vinicius Luiz Barp
(74) Carlo Andreas Dalcanale
(21) MU 8902815-5 U2 (22) 02/10/2009
3.1
(51) A47B 97/00 (2006.01), F16M 13/00 (2006.01), H05K 5/00 (2006.01)
(54) DISPOSIÇÃO INTRODUZIDA EM SUPORTE PARA MÁQUINAS DE
OPERAÇÕES FINANCEIRAS
(57) DISPOSIÇÃO INTRODUZIDA EM SUPORTE PARA MÁQUINAS DE
OPERAÇÕES FINANCEIRAS, idealizada por um suporte vertical para fixação
de máquinas de cartão de crédito, para sua utilização nos estabelecimentos
comerciais do varejo, pertencente ao campo dos acessórios para
estabelecimentos comerciais; apresenta uma estrutura central cilíndrica
principal (2) verticalizada com movimento rotativo em torno do seu eixo
longitudinal, a qual é montada sobre uma base discoidal; a estrutura central
cilíndrica principal (2) apresenta duas projeções cilíndricas (10), as quais
também giram em torno do seu eixo central, cujas extremidades possuem uma
plataforma inclinada rotativa (11), cujo centro de giro é coincidente ao seu
centro de gravidade; ditas plataformas servem de base para a fixação das
máquinas de cartões de crédito, os movimentos rotatórios dos três
componentes combinados, possibilitam um posicionamento espacial adequado
da máquina de cartão de crédito, para que o respectivo usuário possa utilizar o
seu teclado, bem como observar o display com facilidade.
(71) JOSÉ NASCIMENTO SOUSA (BR/SP)
(72) JOSÉ NASCIMENTO SOUSA
(74) José Bueno da Silva Filho
114
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(74) VILAGE MARCAS & PATENTES S /S LTDA
(21) PI 0800013-1 A2 (22) 07/01/2008
3.1
(51) A61G 7/00 (2006.01), A63B 23/02 (2006.01)
(54)
EQUIPAMENTO
PARA
ALONGAMENTO
VERTICAL
E
DESCOMPRESSÃO RADICULAR DA COLUNA VERTEBRAL
(57)
EQUIPAMENTO
PARA
ALONGAMENTO
VERTICAL
E
DESCOMPRESSÃO RADICULAR DA COLUNA VERTEBRAL, consiste de um
equipamento (1) para alongamento passivo das estruturas da coluna vertebral;
constituído por estrutura (2) autoportante dotado de conjunto motorredutor (3)
superior com roldana (4) passível de movimentar, para cima ou para baixo, um
elemento (5) de ligação unifilar a ser fixado a uma vestimenta (V) colocada no
entorno do quadril do usuário com pega (6) central, sendo tal conjunto
motorredutor (3) acionado por controle remoto (7) e curso limitado por sensor
(S).
(71) KLEITON STENGEL (BR/SP)
(72) KLEITON STENGEL
(74) VILAGE MARCAS & PATENTES S/S LTDA
(21) PI 0800098-0 A2 (22) 11/02/2008
3.1
(51) B24B 31/02 (2006.01)
(54) CILINDRO PARA ACABAMENTO DE VÉRTICES DE PEÇAS EM
MADEIRA PARA MOBILIÁRIO EM GERAL
(57) CILINDRO PARA ACABAMENTO DE VÉRTICES DE PEÇAS EM
MADEIRA PARA MOBILIÁRIO EM GERAL, consiste de um cilindro (1) formado
a partir de um corpo (2) dotado de diversos canais (3) de formatos
predominantemente trapezoidais, propiciando fácil encaixe de filetes (4)
longitudinais basicamente constituídos por aba (5) metálica com material
abrasivo (6) em um dos lados e por fios (7) em PVC ou Piva formando um filete
(4) escova que ao girar juntamente com o cilindro (1) promove o acabamento de
determinada peça em madeira (não representada), principalmente em seus
cantos ou vértices, tomado a operação mais eficiente, reduzindo seu tempo e
melhorando a relação custo x beneficio.
(71) Crippa Máquinas e Equipamentos Ltda (BR/SP)
(72) Francisco Carlos Crippa
(21) PI 0800141-3 A2 (22) 13/02/2008
3.1
(51) C02F 3/34 (2006.01)
(54) MÉTODO PARA REMOÇÃO DE POLUENTES DA ÁGUA DE PRODUÇÃO
DE PETRÓLEO
(57) MÉTODO PARA REMOÇÃO DE POLUENTES DA ÁGUA DE PRODUÇÃO
DE PETRÓLEO. Método que promove a melhoria da qualidade do efluente
proveniente do processo de produção industrial de petráleo, usualmente
denominado água de produção de petróleo. O presente método permite a
redução da concentração de poluentes na água de produção de petrôleo a ser
tratada, mediante a remoção desses poluentes fazendo uso de culturas de
microalgas que passaram por um processo de seleção natural e que estão
naturalmente adaptadas ao ambiente hostil oferecido pela água de produção de
petróleo.
(71) PETROLEO BRASILEIRO S.A. - PETROBRAS (BR/RJ)
(72) Leonardo Brantes Bacellar Mendes, Paulo Cesar Rodrigues Cunha,
Marcelo Gonçalves Montes D' Oca, Paulo César Abreu, Ednei Gilberto Primel
(74) Seldon Parkes
(21) PI 0800228-2 A2 (22) 24/01/2008
3.1
(51) A61K 36/886 (2006.01), A61K 36/47 (2006.01), A61K 36/534 (2006.01),
A61K 8/97 (2006.01)
(54) PROCESSO PARA OBTENÇÃO DE TÔNICO CAPILAR E TÔNICO
CAPILAR
(57) PROCESSO PARA OBTENÇÃO DE TÓNICO CAPILAR E TÔNICO
CAPILAR especialmente de um tônico capilar o qual é apresentado na forma de
líquido ou "spray", passível de melhor distribuição, sendo todos os
componentes naturais tendo como princípio ativo o óleo de rícino, além dos
aspectos inerentes a formulação, o presente tônico capilar apresenta alto poder
condicionante e desembaraçador, ou ainda como formador ou ativador de
cachos. Adicionalmente, mantendo o óleo de ricino como principio ativo podeser agregar outros componentes específicos para outras funções, além de
tonificar.
(71) Tadao Anzai (BR/SP) , Queico Anzai (BR/SP) , Toshiaki Anzai (BR/SP)
(72) Tadao Anzai, Toshiaki Anzai, Queico Anzai
(74) VILAGE MARCAS & PATENTES S / S LTDA
(21) PI 0800276-2 A2 (22) 08/01/2008
3.1
(51) A43D 21/00 (2006.01)
(54) APERFEIÇOAMENTO EM MÁQUINA CONFORMADORA DE CALÇADOS
(57) APERFEIÇOAMENTO EM MÁQUINA CONFORMADORA DE CALÇADOS.
A invenção refere-se ao aperfeiçoamento em máquina conformadora de
calçados que apresenta um inovador sistema de circulação e distribuição de ar.
A máquina compreende uma cúpula (1) que é alimentada por dois conjuntos de
ventiladores (2) e dois sistemas de injeção d'água para vapor (3), fazendo com
que o ar seja distribuído uniformemente nos dois lados da cúpula de
conformação do calçado. A cúpula (1) possui uma saida de ar (4) com
regulagem de abertura na parte superior, permitindo que o excesso de vapor
seja removido de seu interior. A cúpula (1) é revestida com isolamento térmico e
suspensa no gabinete por pontos no interior da máquina, criando uma câmara
de ar (5) entre a cúpula e a carenagem externa. Como o ar é isolante, não temse pontes térmicas que transmitam calor por condução da parte interna para a
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 115
carenagem, reduzindo-se o aquecimento externo da máquina. A cúpula (1)
apresenta arredondamentos (6) com raios longos que possibilitam que o ar seja
guiado diretamente até a posição em que irá atingir o calçado, não gerando
perdas de velocidade do ar e nem turbulências internas que diminuam o
rendimento do sistema.
(71) Máquinas Sazi Ltda (BR/RS)
(72) Antônio Patrício Zini
(74) Custódio de Almeida & Cia
(21) PI 0800277-0 A2 (22) 08/01/2008
3.1
(51) A43D 25/06 (2006.01)
(54) APERFEIÇOAMENTO EM MÁQUINA ESTABILIZADORA A FRIO
(57) APERFEIÇOAMENTO EM MÁQUINA ESTABILIZADORA A FRIO. A
invenção refere-se ao aperfeiçoamento em máquina estabilizadora a frio
destinada a cristalizar a cola aplicada em calçados após a colagem da sola que
apresenta um inovador sistema de circulação e distribuição de ar. A máquina
compreende ventiladores (1) posicionados entre o evaporador (2) e a esteira
transportadora (3), sendo que os ventiladores (1) sopram o ar de baixo da
esteira (3) fazendo com que o ar entre em contato primeiramente com a sola do
calçado (4), gerando uma turbulência (5) ao passar pelo cabedal. O evaporador
(2) está suspenso na parte interna da máquina, fazendo com que o ar ao ser
succionado pelos ventiladores (1) passe por toda a área do evaporador (2),
aproveitando melhor a capacidade de resfriamento do equipamento e reduzindo
a criação de gelo oriundo da umidade do ar. A cúpula (6) está suspensa através
dos suportes (7) apoiados na base (8) da máquina, sem contato com as
paredes, evitando assim a passagem de frio e a condensaçao na parte externa
da máquina. A cúpula (6) possui cantos arredondados (9), facilitando a
circulação do ar, reduzindo a turbulência no reaproveitamento do ar e
permitindo o uso de ventiladores (1) axiais. A cúpula (6) possui tampas laterais
(11) que facilitam o acesso aos componentes internos, agilizando a manutenção
e a limpeza interna do equipamento. A cúpula (6) é envolvida por uma camada
de isolamento térmico (12) que aumenta a eficiência da operação de
estabilização da cola. A água de degelo e da umidade gerada no interior da
máquina é coletada pela bandeja de fundo cônico (13) da cúpula (6) e
transferida por gravidade para uma bombons (14) e desta para um recipiente
(15). Uma serpentina (16) está conectada na saída de gás quente do
compressor (17) e está mergulhada no recipiente (15). Essa serpentina (16)
emprega o calor gerado pelo processo de compressão, sem consumo adicional
de energia, para evaporar a água proveniente do degelo e da umidade gerada
pela máquina, dispensando a operação de retirada de água da máquina pelo
operador.
(71) Máquinas Sazi Ltda (BR/RS)
(72) Antônio Patrício Zini
(74) Custódio de Almeida & Cia
(21) PI 0804668-9 A2 (22) 17/10/2008
3.1
(51) G01K 1/16 (2006.01), G01N 25/62 (2006.01)
(54) APERFEIÇOAMENTO EM PÊNDULO DE MEDIÇÃO PARA MASSA DE
GRÃOS ARMAZENADOS
(57) APERFEIÇOAMENTO EM PÊNDULO DE MEDIÇÃO PARA MASSA DE
GRAOS ARMAZENADOS em que um medidor tipo pêndulo (1) formado por
uma estrutura de proteção (2), aloja em seu interior sensores (3) que tem a
interface direta com o exterior por meio de uma ou mais passagens transversais
(4) providas de proteção porosa (5), de modo a medir as variáveis desejadas do
ar intersticial, que atravessa a proteção porosa (5) e representa as
características reais dos grãos no exterior.
(71) Otalício Pacheco da Cunha (BR/RS)
(72) Otalício Pacheco da Cunha
(74) Gilson Aleida da Motta
(21) PI 0901098-0 A2 (22) 30/03/2009
3.1
(51) C04B 18/20 (2006.01), C04B 18/22 (2006.01), C04B 18/06 (2006.01)
(54) COMPOSIÇÃO DISTINTA PARA COMPÓSITO APLICADO NA
CONSTRUÇÃO CIVIL
(57) COMPOSIÇÃO DISTINTA PARA COMPOSITO APLICADO NA
CONSTRUÇÃO CIVIL. A presente patente de privilégio de invenção tem por
objetivo o desenvolvimento de uma argamassa para sustentação complementar
adicionada nos canais internos de tijolos convencionais, tijolos de encaixe,
artefatos compostos e blocos visando contribuir com o volume de reciclagem
dos materiais plásticos somados a borrachas, auxilio na captura do dióxido de
carbono e diminuição de suas emissões na atmosfera consistindo na
argamassa (1) representada nos canais e orifícios dos tijolos (2) e do bloco (3)
composta por carbonato de cálcio, polímeros termoplásticos juntamente com
pneus fragmentados em micro-partículas com granulometria preferencial e
resíduos industriais coletados de filtros adaptados em dutos e chaminés de
fábricas, geralmente desprezados após a saturação dos elementos filtrantes.
Sua maior preocupação vem de encontro com a preservação dos ambientes
naturais remanescentes, oferecendo alternativas para reduzir emissões do
diôxido de carbono, grande beneficiário do aquecimento global, através da
depreciação, neste caso, do elemento cimento e a remoção de matérias de
baixa degradação natural num resultado benéfico tanto para a construção civil
como ao clima e tudo que envolve os biomas mundiais.
(71) José Vanderlei Taques (BR/PR)
116
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
(72) José Vanderlei Taques
(74) Marcos Antonio Nunes
(21) PI 0903766-7 A2 (22) 29/09/2009
3.1
(51) A47J 45/02 (2006.01), A47K 10/10 (2006.01)
(54) DISPOSITIVO COM FIXAÇÃO POR VENTOSAS PARA SUPORTE DE
PAPEL-TOALHA E AFINS
(57) DISPOSITIVO COM FIXAÇÃO POR VENTOSAS PARA SUPORTE DE
PAPEL-TOALHA E AFINS. Trata-se de um dispositivo compreendido por um
sistema de ventosas (1) que promovem a fixação do suporte em qualquer
superficie lisa, como paredes, armários, geladeira, vidraças, etc.;
compreendido, também, por um cilindro (4) para rolagem do papel-toalha, ou
produtos similares, como papel-higiénico, papel-alumínio, guardanapos,
sacolas, filme plástico, etc.; desde que estes apresentem disposição em rolo, ou
seja, com bobina central por onde se possa passar o cilindro (4) do suporte;
sendo que o referido dispositivo é compreendido por duas ventosas (1); uma
chapa (2); dois pinos (3); e, um cilindro (4).
(71) Sebastião Romano Ladislau (BR/ES)
(72) Sebastião Romano Ladislau
(74) Wagner José Fafa Borges
(21) PI 0903803-5 A2 (22) 30/09/2009
3.1
(51) C07D 317/50 (2006.01), C07D 241/08 (2006.01), A61K 31/405 (2006.01),
A61K 31/48 (2006.01), A61P 15/00 (2006.01), A61P 9/12 (2006.01)
(54) COMPOSTO, ISÔMERO DO COMPOSTO, PROCESSO DE SUA
PREPARAÇÃO,
COMPOSTO
INTERMEDIÁRIO,
COMPOSIÇÃO
FARMACÊUTICA; MEDICAMENTO, USO DOS COMPOSTOS E MÉTODO DE
TRATAMENTO
(57) DISPOSITIVO COM FIXAÇÃO POR VENTOSAS PARA SUPORTE DE
PAPEL-TOALHA E AFINS. Trata-se de um dispositivo compreendido por um
sistema de ventosas (1) que promovem a fixação do suporte em qualquer
superficie lisa, como paredes, armários, geladeira, vidraças, etc.;
compreendido, também, por um cilindro (4) para rolagem do papel-toalha, ou
produtos similares, como papel-higiénico, papel-alumínio, guardanapos,
sacolas, filme plástico, etc.; desde que estes apresentem disposição em rolo, ou
seja, com bobina central por onde se possa passar o cilindro (4) do suporte;
RPI 2109 de 07/06/2011
sendo que o referido dispositivo é compreendido por duas ventosas (1); uma
chapa (2); dois pinos (3); e, um cilindro (4).
(66) PI0804119-9 30/09/2008
(71) Biolab Sanus Farmacêutica Ltda (BR/SP)
(72) Sérgio Luiz Sacurai, Carlos Eduardo da Costa Touzarim, Marcio Henrique
Zaim
(74) Ana Cristina Müller Wegmann
(21) PI 0903822-1 A2 (22) 29/09/2009
3.1
(51) H02M 5/02 (2006.01)
(54) CIRCUITO GERADOR DE TENSÃO MÍNIMA DE TRABALHO
(57) CIRCUITO GERADOR DE TENSÃO MINIMA DE TRABALHO, capaz de
estabelecer como tensão de trabalho um valor mínimo, ou seja, 102 volts para
redes de 127 volts e 198 volts para redes de 220 volts. Partindo deste principio
se criou um circuito que estabelece como tensão de trabalho no valor mínimo,
ou seja, 102 volts para redes de 127 volts e 198 volts para redes de, 220 volts a
tensão a partir do circuito da F1. O que se busca é economia de energia
elétrica, redução de perdas por aquecimento, redução de queima e vida mais
longa a tudo o que ficar ligado na rede que esta sendo controlada pelo circuito
da F1.
(71) Pedro Nelson Klassmann (BR/RS)
(72) Pedro Nelson Klassmann
(74) Abdulcarim Bakkar
(21) PI 0903826-4 A2 (22) 29/09/2009
3.1
(51) C02F 9/00 (2006.01), C02F 101/30 (2006.01), C02F 101/32 (2006.01),
C02F 3/32 (2006.01)
(54) PROCEDIMENTO PARA OBTENÇÃO DE UMA GRAXA E/OU ÓLEO A
PARTIR DE RESÍDUOS INDUSTRIAIS PARA SUA UTILIZAÇÃO COMO
MATÉRIA PRIMA DE COMBUSTÍVEIS
(57) PROCEDIMENTO PARA OBTENÇÃO DE UMA GRAXA E/OU ÓLEO A
PARTIR DE RESÍDUOS INDUSTRIAIS PARA SUA UTILIZAÇÃO COMO
MATERIA PRIMA DE COMBUSTÍVEIS, consiste num procedimento que
compreende um 1º passo de acidificação; um 2º passo de centrifugação; um 3º
passo de extração de graxa e ácidos graxos; um 4º passo de separação; um 5º
passo de destilação; um 6º passo de tratamento num tanque grande de matéria
orgânica não gordurosa com microalgas e um 7º passo onde é realizada uma
esterificação ou uma transesterificação conforme o grau de acidez.
(71) Jorge Alejandro Piwko (AR)
(72) Jorge Alejandro Piwko
(74) Marcelo Brizolara de Freitas
(21) PI 0903937-6 A2 (22) 09/10/2009
3.1
(51) A23D 9/04 (2006.01)
(54) PROCESSO PARA A PRODUÇÃO DE DIACILGLICERÓIS ATRAVÉS DE
REAÇÕES DE GLICERÓLISE E HIDRÓLISE DE ÓLEOS VEGETAIS
CATALISADAS PELAS ENZIMAS LIPOZYME TL IM, LIPOZYME RM IM E
NOVOZYME 435
(57) PROCESSO PARA A PRODUÇÃO DE DIACILGLICERÓIS ATRAVES DE
REAÇÕES DE GLICERÓLISE E HIDRÓLISE DE ÓLEOS VEGETAIS
CATALISADAS PELAS ENZIMAS LIPOZYME TL IM, LIPOZYME RM IM E
NOVOZYME 435. A presente invenção refere-se a um processo para a
produção de 1,2 e 1,3 diaciigliceróis catalisado por enzimas, a partir de duas
RPI 2109 de 07/06/2011
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 117
abordagens: hidrólise de material lipídico para a geração de diacilgliceróis e
reação de glicerólise para a geração de diacilgliceróis. No processo ora em
questão, são empregadas as lipases comerciais Lipozyme TL IM, Lipozyme RM
IM e Novozyme 435 para catalisar a produção de diacilgliceróis através da
hidrólise de material lipídico de óleos vegetais. Neste processo, as referidas
lipases comerciais também são empregadas para catalisar a produção de
diacilgliceróis através da glicerólise de material lipídico. Diferentes condições
reacionais são empregadas, onde variações de temperatura, quantidade de
enzima e tempos de reação foram estudados.
(71) Companhia Refinadora da Amazônia (BR/SP)
(72) Rodrigo Octavio Mendonça Alves de Souza, Ingrid Chastinet Ribeiro Costa,
Flávia de Abreu Corrêa
(74) Di Blasi, Parente, Vaz e Dias & AL
(21) PI 0903943-0 A2 (22) 08/10/2009
3.1
(51) A63B 21/02 (2006.01)
(54) DISPOSITIVO INDIVIDUAL PARA A PRÁTICA DE EXERCÍCIO FLEXOEXTENSOR DAS PERNAS
(57) DISPOSITIVO INDIVIDUAL PARA A PRATICA DE EXERCÍCIO FLEXOEXTENSOR DAS PERNAS constituído por um conjunto formado por um cinto
(1), por um colete tipo espaldeira (2) e por colete (3), por um par de faixas (4) e
de par de suportes de calcanhar para uso dentro do tênis ou sandálias (5) e (6),
de três elásticos em "V" (7), (7') e (7") e de pares de elásticos separados para
cada perna (8), (8') e (8"), cujo desenvolvimento visa obter uma solução prática,
barata e cômoda que permite ao usuário exercitar a musculatura das pernas
com o simples ação de andar ou correr.
(71) Julio Cezar Marchetti Mariano (BR/SP)
(72) Julio Cezar Marchetti Mariano
(74) Glauco Zoline
(21) PI 0903947-3 A2 (22) 08/10/2009
3.1
(51) C02F 9/04 (2006.01), C02F 9/14 (2006.01), C02F 103/08 (2006.01), C02F
1/24 (2006.01), C02F 3/02 (2006.01)
(54) SISTEMA DE TRATAMENTO DE CANAIS DE DRENAGEM DE REGIÕES
URBANAS JUNTO À ORLA MARÍTIMA
(57) SISTEMA DE TRATAMENTO DE CANAIS DE DRENAGEM DE REGIÕES
URBANAS JUNTO À ORLA MARITIMA, compreendendo: (a) a captação da
água proveniente do mar (2) em, pelo menos, um ponto da faixa de praia (1)
dessa orla marítima; sendo essa água do mar captada (2) submetida a uma
filtração natural durante sua sucção do lençol submerso (3); (b) o lançamento
dessa água do mar filtrada (2) contra corrente ou não em cada um dos canais
de drenagem (4) da região urbana (5) vizinha à orla marítima, de modo que o
volume de água de drenagem (6) dos referidos canais (4) seja diluído e/ou
retrolavado ao longo do curso desse canal (4); (c) o lançamento de forma
contínua ou não, desse volume de água residual (26), em um processo de
flotação (7) em fluxo e níveis variáveis no próprio canal de drenagem, no qual
essa água residual (27) antes de ser lançada novamente no mar (2) e/ou ser
direcionada a uma lagoa (9) para utilização ligada a recreação, lazer de contato
primário ou reservatório de criação animal é submetida a aplicação de material
floculante ou coagulante, seguido de mícroaeração e desinfecção da massa
líquida.
(71) DT Engenharia de Empreendimentos Ltda. (BR/SP)
(72) João Carlos Gomes de Oliveira, Procópio Gomes de Oliveira Netto, Felipe
Gomes de Oliveira
(74) Paulo Cesar Vaz Machado
(21) PI 0903959-7 A2 (22) 08/10/2009
3.1
(51) A61M 37/00 (2006.01)
(54) MÁQUINA ROTATIVA PARA DERMOPIGMENTAÇÃO
(57) MÁQUINA ROTATIVA PARA DERMOPIGMENTAÇÃO. A presente
invenção refere-se ao desenvolvimento de uma máquina de acionamento
rotativo para dermopigmentação, destinada a aplicação de substâncias,
normalmente corantes orgânicos, abaixo da derme através do movimento da
haste porta-agulha (1) ser linear e ter as vibrações laterais e indesejáveis na
haste porta-agulha (1) minimizadas. O movimento linear da haste porta-agulha
(1) é proporcionado pelo excêntrico (2) conectado ao eixo do motor (3). A haste
porta-agulha (1) é conectada ao excêntrico (2) por meio de uma biela (4), este
último sendo opcional, mas quando está incluso proporciona uma maior gama
de regulagens e opções de projeto. Essa configuração proporciona um
movimento cíclico e constante da haste de agulhas, o dimensionamento de
cada parte do sistema - excêntrico, biela e haste porta-agulha - irá detenninar a
linearidade do movimento da haste de agulha, assim como o curso efetivo,
velocidade de penetração, velocidade de retomo e força aplicada na aresta
cortante - agulhas.
(71) Hugo Flávio Benassi Zanqueta (BR/PR)
(72) Hugo Flávio Benassi Zanqueta
(21) PI 0903946-5 A2 (22) 09/10/2009
3.1
(51) B65D 35/28 (2006.01)
(54) DISPOSIÇÃO CONSTRUTIVA APLICADA EM DISPOSITIVO APLICADOR
DE CREME CORPORAL
(57) DISPOSIÇÃO CONSTRUTIVA APLICADA EM DISPOSITIVO APLICADOR
DE CREME CORPORAL compreendido por um corpo principal constituído a
partir de uma base, dotada de cavidade acondicionadora, cuja secção inferior e
comunicante com um gargalo que se estende formando um pescoço
semiesférico que recebe o acoplamento de uma esfera dosadora, enquanto a
secção mediana projeta um rebaixo, sendo a secção superior em sua face
externa é provida de rosca para fixação da tampa, cuja secção superior detém
um gargalo que projeta um pescoço em semicírculo para acoplamento de uma
esfera massageadora, sendo que os ditos pescoços recebem uma tampa
protetora, enquanto o rebaixo recebe o engate de um braço telescópico, em
uma disposição derivativa a base em sua secção mediana projeta um suporte
de onde se estende um braço telescópico.
(71) Sonia Regina Micelli Lupinacci (BR/SP)
(72) Sonia Regina Micelli Lupinacci
(74) Mercantil Assessoria em Marcas e Patentes S/C Ltda
118
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
utilização em ponta de espiral de cadernos, agendas, calendários, livros
didáticos, apostilas e similares que tem por finalidade prevenir o usuário contra
a possibilidade de ferimento e/ou prejuízos causados pelo contato das pontas
do espiral com o corpo e/ou tecidos em geral, como blusas, calças, mochilas,
etc. O dito fecho de segurança é constituído das seguintes partes: passagem
primária (1); prolongamento primário (2); dobra de ligação (3); passagem
secundária (4); prolongamento secundário (5); e abertura para visualização (6).
Ele é soldado à ponta (9) do espiral (8) para a devida fixação. Assim sendo,
define-se a presente Patente de Invenção como um fecho que possui atrativo
estético, prático, eficiente, seguro e lucrativo, uma vez que estimula o comércio
de cadernos, agendas, calendários, livros didáticos, apostilas e similares devido
à possibilidade de escolha de diferentes cores no momento da fabricação.
(71) MÁRCIO SÉRGIO PEREIRA DA FONSECA (BR/BA)
(72) MÁRCIO SÉRGIO PEREIRA DA FONSECA
(74) Algo Alliance Assessoria em Propriedade Intelectual Ltda
(21) PI 0903966-0 A2 (22) 09/10/2009
3.1
(51) B42D 3/02 (2006.01)
(54) CAPA FABRICADA EM POLITEREFTALATO DE ETILENO OU CLORETO
DE
POLIVINILA
RECICLADOS
PARA
CADERNOS,
AGENDAS,
CALENDÁRIOS, LIVROS DIDÁTICOS, APOSTILAS E SIMILARES E
RESPECTIVO PROCESSO DE FABRICAÇÃO
(57) CAPA FABRICADA EM POLITEREFTALATO DE ETILENO OU CLORETO
DE
POLIVINILA
RECICLADOS
PARA
CADERNOS,
AGENDAS,
CALENDÁRIOS, LIVROS DIDÁTICOS, APOSTILAS E SIMILARES, E
RESPECTIVO PROCESSO DE FABRICAÇÃO. A presente Patente de
Invenção refere-se a uma capa fabricada em politerefialato de etileno ou cloreto
de polivinila reciclados, e respectivo processo de fabricação que tem por
finalidade conciliar um produto de qualidade (produzido por "vacuum forming")
com o atendimento da necessidade de desenvolvimento sustentável. A dita
capa (1) é fabricada em material reciclado (2), de PET ou PVC, e é constituída
pela parte frontal (3) e pela parte posterior (4). Ambas as partes são dotadas de
furos (5), os quais são atravessados pela espiral (6) que conecta as referidas
partes, envolvendo os papéis (7) situados entre elas. Para a produção da capa
(1), o material reciclado (2) sofre a conformação (8) em moldes, passando
finalmente pela moldagem com sucção a vácuo (9). Deste modo, define-se a
presente Patente de Invenção como algo que soluciona o problema atual de
capas produzidas com um alto custo, da demora em suas confecções e de suas
baixas durabilidades, superando as dificuldades encontradas na produção de
uma capa de material reciclado que atenda à demanda de mercado e que
contribua com a preservação ambiental e o crescimento econômico.
(71) MÁRCIO SÉRGIO PEREIRA DA FONSECA (BR/BA)
(72) MÁRCIO SÉRGIO PEREIRA DA FONSECA
(74) Algo Alliance Assessoria em Propriedade Intelectual Ltda
(21) PI 0903967-8 A2 (22) 09/10/2009
3.1
(51) B42D 1/00 (2006.01), B42D 3/10 (2006.01)
(54) FECHO DE SEGURANÇA FABRICADO EM POLITEREFTALATO DE
ETILENO, CLORETO DE POLIVINILA OU POLIPROPILENO RECICLADOS
PARA UTILIZAÇÃO EM PONTA DE ESPIRAL DE CADERNOS, AGENDAS,
CALENDÁRIOS, LIVROS DIDÁTICOS, APOSTILAS E SIMILARES
(57) FECHO DE SEGURANÇA FABRICADO EM POLITEREFTALATO DE
ETILENO, CLORETO DE POLIVINILA OU POLIPROPILENO RECICLADOS
PARA UTILIZAÇÃO EM PONTA DE ESPIRAL DE CADERNOS, AGENDAS,
CALENDÁRIOS, LIVROS DIDÁTICOS, APOSTILAS E SIMILARES. A presente
Patente de Invenção refere-se a um fecho de segurança fabricado em
politerefialato de etileno, cloreto de polivinila ou polipropileno reciclados para
(21) PI 0903968-6 A2 (22) 09/10/2009
3.1
(51) A23G 1/10 (2006.01)
(54) TEMPERADEIRA DE ADIÇÃO
(57) TEMPERADEIRA DE ADIÇÃO. A presente invenção refere-se a uma
temperadeira de adição (1), particularmente para temperar chocolate, massa de
cacau ou materiais que tenham em sua composição gorduras cristalizáveis
obtidas através da adição de sólidos, dotada de uma cuba (2) para
posicionamento do material a temperar (M); de um disco (3) vertical,
parcialmente mergulhado no material (M) da cuba (2) que, em seu movimento
de rotação, carrega consigo o material (M) aderido em suas faces, além de
homogeneizar o material (M) na cuba (2).
(71) ADRIANO SARTORI PEDROSO (BR/SP)
(72) ADRIANO SARTORI PEDROSO
(74) MARIA BEATRIZ CORREA DA SILVA MEYER GAIARSA
(21) PI 0903969-4 A2 (22) 09/10/2009
3.1
(51) F24J 2/24 (2006.01)
(54) COLETOR MODULAR DE ENERGIA TÉRMICA PARA SISTEMAS DE
CAPTAÇÃO DE ENERGIA SOLAR
RPI 2109 de 07/06/2011
(57) COLETOR MODULAR DE ENERGIA TÉRMICA PARA SISTEMAS DE
CAPTA ÇAO DE ENERGIA SOLAR. Trata esta patente de um coletor modular
de energia térmica para sistemas de aquecimento solar de água, propiciando
elevando eficiência na captação da energia, e tendo um custo muito baixo de
fabricação e instalação. Em suas linhas gerais, a novidade consiste de um
coletor de material temioplástico, formando uma peça única e inteiriça, a qual
apresenta como parte estrutural principal um corpo retangular (1) de base plana
(2), obtido por extrusão, exibindo uma sucessão de pequenas intumescências
paralelas semi- circulares (3), estendendo-se de uma aresta lateral do corpo até
a aresta contraposta e se apresentando vasadas, cada uma estando separada
das que lhe são contíguas por um pequeno setor plano (4) que integra a
superficie (2) da base, com o interior destas intumescências dividindo-se em
dois condutos paralelos (5) formados por uma parede periférica (6) que
descreve um arco de 90º uma segunda parede (7), vertical, e a superficie
horizontal (2) da base, todas tendo uma espessura muito reduzida. O coletor é
complementado pela adição aos extremos laterais do corpo (1) de dois tubos
cilíndricos contrapostos (8) e (8A) de grande diâmetro, no mesmo material do
corpo, sendo tais tubos conformados por meio de duas operações sucessivas
de sobre-injeção nas laterais do corpo, com a superfície interna ( 9) de cada
tubo ( 8) e ( 8A) concordando com a respectiva extremidade de cada
intumescência (3), de modo que as aberturas de cada conduto (5) comunicamse com o interior destes tubos, cada um deles apresentando um conjunto de
projeções (10) que conformam curtos segmentos semicirculares (11) que
envolvem os extremos das intumescências (3). O coletor é complementado
ainda por um par de tampas (12) e (12A), cada uma predisposta para se
encaixada em uma das aberturas (13) da extremidade de um dos tubos (8),
presa com adesivo ou outro meio adequado, enquanto o extremo oposto deste
receberá uma conexão que o ligará à tubulação de água fria, enquanto a outra
tampa (12A) fechará a abertura do outro tubo (8A) diagonalmente aposta à
primeira tampa, enquanto a abertura livre do segundo tubo (8A), será igada à
tubulação que conduz a água aquecida.
(71) ATENA TECNOLOGIA INDUSTRIAL E COMÉRCIO DE ELETROELETRÔNICOS LTDA. (BR/SP)
(72) Luiz Eduardo Monteiro de Oliveira
(74) Italo Muglia de Marchi
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 119
(21) PI 0903987-2 A2 (22) 08/10/2009
3.1
(51) A45D 40/02 (2006.01), A45D 40/06 (2006.01)
(54) APERFEIÇOAMENTO EM EMBALAGEM PARA BATOM
(57) APERFEIÇOM4ENTO EM EMBALAGEM PARA BATOM, compreendendo
um acabamento externo definido por uma primeira peça inferior ordinariamente
tubular definida como pega (1), cuja extremidade superior diametralmente
reduzida (2) confere encaixe para outra peça ordinariamente tubular definida
como tampa (3), esta e a anterior podem ter o seu feitio externo com qualquer
geometria decorativa, porém, pelo lado interno, conferem meios circulares para
alojamento de um mecanismo telescópico (4) que expõe e recolhe a bala de
batom (5), o qual é constituído por corpo em peça única (6) tendo internamente
um êmbolo (12) de suporte para a bala de batom (5), êmbolo este movimentado
para cima ou para baixo através de came definido por uma luva (14), expondo
ou recolhendo a dita bala de batom (5).
(71) Ipel Indústria de Pinceis e Embalagens Ltda. (BR/SP)
(72) Oscar Aparecido Generali
(74) Edmundo Brunner Ass Em Prop. Indl. Ltda
(21) PI 0903978-3 A2 (22) 09/10/2009
3.1
(51) E04C 3/09 (2006.01), E04C 5/06 (2006.01), E04B 1/24 (2006.01)
(54) ESPAÇADOR DE VIGA ESTRUTURADA
(57) ESPAÇADOR DE VIGA ESTRUTURADA, descreve-se a presente patente
de invenção como um espaçador de viga estruturada que, de acordo com as
suas características, propicia a formação de um espaçador (1) em estrutura
monobloco própria e específica do tipo mecânica aplicável diretamente em
vigas estruturadas (A) em geral como elemento de espaçamento de pares de
vigas, com vistas a possibilitar de forma extremamente prática, segura e precisa
uma completa otimização no conjunto de procedimentos de estruturação de
vigas estruturadas (A) e similares em geral e, tendo como base, um espaçador
(1) com grande resistência, segurança e versatilidade facilmente adaptável a
uma vasta gama de vigas estruturadas, usuários e locais em geral.
(71) Carlos Matthias Moosmayer (BR/PR)
(72) Carlos Matthias Moosmayer
(74) Ildo Ritter de Oliveira
(21) PI 0903980-5 A2 (22) 08/10/2009
3.1
(51) B66F 11/04 (2006.01), A61G 3/00 (2006.01)
(54) PLATAFORMA ELEVATÓRIA VEICULAR
(57) PLATAFORMA ELEVATORIA VEICULAR. Plataforma elevatória destinada
a pessoas portadoras de necessidades especiais e/ou com dificuldades
locomotoras para acesso a veículos e edificações em geral, dotada de
dispositivos mecânicos e eletromecânicos, semiautomatizados, compreendendo
sistema de segurança, sistema de acesso, sistema eletromecânico e sistema de
trava, apresentando em sua seção inferior mesa elevatória (6) dotada de
plataforma deslizante (8) retrátil, ambas com piso em material antiderrapante,
cuja projeção é feita através do desbloqueio manual das travas (7), rampa de
acesso (31) com sistema de travamento mecânico acionadas pela utilização de
molas (27, 28) e barreiras (29); degrau (9) intermediário retrátil com alavanca
(11) para acionamento manual e perfil de sustentação (10); apresentar em suas
seções laterais dois corrimáos (37) que ostentam puxador (21) manual das
travas (7), duas colunas (2) contendo cada qual um fuso (1) mecânico
delimitado por mancais (5) e botões de acionamento e sinalizadores (15); em
sua seção posterior apresentar caixa de transmissão (12), motor (13), sistema
eletrónico (14) de controle para acionamento de um par de fusos (1) mecânicos
paralelos tendo seus eixos de rotação sincronizados pela caixa de transmissãoredução (12, 13), que ao girarem elevam ou abaixam porcas (3) no formato
quadrangular para detecção de obstáculos durante o percurso descendente,
solidárias à plataforma (8) e acopladas lateralmente à mesa (6).
(71) Sammetal Metalúrgica Ltda (BR/MG)
(72) Adílson Cândido dos Reis
(74) Sâmia Batista Amin
(21) PI 0903989-9 A2 (22) 07/10/2009
3.1
(51) F03G 3/08 (2006.01), H02K 7/06 (2006.01)
(54) EQUIPAMENTO COM MECANISMO DE HIDROGRAVIDADE PARA
GERAÇÃO DE ENERGIA LIMPA
(57) EQUIPAMENTO COM MECANISMO DE HIDROGRAVIDADE PARA
GERAÇÃO DE ENERGIA LIMPA. A invenção revela um mecanismo baseado
em hidrogravidade com finalidade de servir de força motriz para movimentar um
gerador de energia, transformando energia mecânica em elétrica, sendo
composto por uma plataforma (1) de hidrogravidade, pistões hidráulicos (2),
válvulas de retenção (3), molas (4), mangueiras (5), motor hidráulico (6),
compressor ou bomba d'água (7), reservatório de ar/água (8), turbina ar/água
(9) e gerador (10).
(71) MARCOS FERREIRA DA SILVA (BR/SP)
(72) MARCOS FERREIRA DA SILVA
(74) EDNÉIA CASAGRANDE PINHEIRO
120
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
(72) Tito José Bonagamba, Leni Campos Akcelrud, Tereza Dib Zambon Atvars,
José Roberto Tozoni, Francisco Eduardo Gontijo Guimarães
(74) Maria Aparecida de Souza
(21) PI 0903990-2 A2 (22) 07/10/2009
3.1
(51) A21D 13/08 (2006.01), A21D 8/06 (2006.01), A23L 1/10 (2006.01)
(54) BOLO DE COCO COM CALDA DE AÇÚCAR E POLVILHADO COM
COCO SECO FINO E SEU PROCESSO DE OBTENÇÃO
(57) BOLO DE COCO COM CALDA DE AÇÚCAR E POLVILHADO COM
COCO SECO FINO E SEU PROCESSO DE OBTENÇÃO. A invenção diz
respeito a um processo para obtenção de um bolo de coco com calda de açucar
e polvilhado com coco seco fino, enquadrado como produto alimentício,
constituído dos seguintes ingredientes: 190 g a 210 de farinha especial
superior; 13g a 15 g de fermento químico para bolos; 150g a 155 g de açúcar
refinado; 8,5g a 9 g de amido de milho; 10g a 12g de coco seco fino importado;
3 ovos médios aproximadamente 150 g; 18g a 20g de emulsificante cor laranja
para bolos; 35 ml a 40 ml de água filtrada a temperatura ambiente; 85 ml a 90
ml de leite tipo B ou A, a temperatura ambiente; e, 8 ml a 10 ml de essência de
coco líquida. A invenção ainda se refere a uma maneira de preparo e colocação
da calda e cobertura bem como um processo de fabricação e obtenção do
referido bolo.
(71) EMERSON ROBERTO SGOBBI (BR/SP)
(72) EMERSON ROBERTO SGOBBI
(74) EDNÉA CASAGRANDE PINHEIRO
(21) PI 0903991-0 A2 (22) 07/10/2009
3.1
(51) A01C 7/10 (2006.01), A01B 71/04 (2006.01)
(54) APERFEIÇOAMENTO EM UNIDADE DE AUTOMAÇÃO DE
PLANTADEIRAS
(57) APERFEIÇOAMENTO EM UNIDADE DE AUTOMAÇÃO DE
PLANTADEIRAS, constituído por caixas de depôsito(1) acopladas sobre barras
de pesagem(2) interligadas a célula de carga(3) ligada a caixa de controle(4),
interligada aos sensores de velocidade dos pneus(5) solidários ao sensor de
taxa de aplicação de sementes(6) e sensor de taxa de aplicação de
fertilizante(7) interligada aos sensores de rotação dos motores hidráulicos de
distribuição fertilizante(8) e de sementes(9), interligados ao comando de
distribuição(1O) e regulagem de fluxo da bomba de alimentação hidráulica(11),
solidária ao tanque de óleo(12) e á conexão (13) do computador de bordo que
recebe as informações filtradas pela caixa de controle(4), para automatizar
quaisquer modelos de plantadeira disponível no mercado, ajustando a
velocidade dos motores de acordo com o determinado pelo conceito de taxa
variável de distribuição que, divide o setor a ser plantado em quadrantes, e que
possuem as taxas de distribuição obtida pela análise do solo, para garantir um
resultado 100% preciso.
(71) BMC AUTOMAÇÃO LTDA (BR/PR)
(72) TATIANI MAZUR
(74) MANOEL PAIXÃO DO NASCIMENTO
(21) PI 0903993-7 A2 (22) 06/10/2009
3.1
(51) C09K 11/00 (2006.01), C09K 11/06 (2006.01), C08L 101/00 (2006.01)
(54) COMPOSIÇÕES POLIMÉRICAS FOTOLUMINESCENTES, BLENDAS
POLIMÉRICAS FOTOLUMINESCENTES, VERNIZ FOTOLUMINESCENTE,
PROCESSOS DE PREPARAÇÃO E USO DOS MESMOS
(57) COMPOSIÇÕES POLIMERICAS FOTOLUMINESCENTES, BLENDAS
POLIMÉRICAS FOTOLUMINESCENTES, VERNIZ FOTOLUMINESCENTE,
PROCESSOS DE PREPARAÇÃO E USO DOS MESMOS. A presente invenção
consiste em composições poliméricas fotoluminescentes, biendas poliméricas
fotoluminescentes e verniz fotoluminescente formados pela mistura de um ou
mais polímeros fotoluminescentes com uma ou mais resinas constituídas por
qualquer tipo de polímero vítreo ou elastomérico. Trata, também, de seus
processos de preparação e uso dos mesmos. Estes novos materiais poliméricos
fotoluminescentes e fosforescentes apresentam alta eficiência de emissão de
luz e menor fotodegradação.
(71) Universidade de São Paulo - USP (BR/SP) , Universidade Estadual de
Campinas - UNICAMP (BR/SP) , Universidade Federal do Paraná - UFPR
(BR/PR)
(21) PI 0903996-1 A2 (22) 06/10/2009
3.1
(51) G05D 7/06 (2006.01), B65D 35/28 (2006.01)
(54) PROCESSO E DISPOSITIVO DOSADOR DE CREME DENTAL
AUTOMATIZADO
(57) PROCESSO E DISPOSITIVO DOSADOR DE CREME DENTAL
AUTOMATIZADO. A patente industrial (PI), visa automatizar a dosagem de
creme dental, utilizando-se de um dispositivo eletrônico, proporcionando
quantidade de dosagem iguais, evitando desperdícios e inconveniências do
processo manual. O sistema automatizado é composto por roletes que
pressionam o conteúdo da pasta de dente. Estes roletes são fixado em um
carro, cuja movimentação dá-se através de um eixo sem fim fixado a um motor
elétrico, sendo o mesmo acionado por um micro controlador que controla as
rotações do motor elétrico, obtendo assim um dosagem perfeita. A dosagem é
programada através de um seletor. O usuário no momento da utilização do
dispositivo aciona o botão de dosagem e todo o sistema entra em operação.
Quando chega-se ao final da utilização do creme dental, o sistema informa ao
usuário que o creme dental acabou. Esta informação é expressa através de um
sinal luminoso ou sonoro ou ainda a combinação de ambos.
(71) GILBERTO ALVES CORRÊA (BR/SP)
(72) GILBERTO ALVES CORRÊA
(21) PI 0903997-0 A2 (22) 05/10/2009
3.1
(51) F16K 31/06 (2006.01), F02N 19/00 (2010.01)
(54) VÁLVULA SOLENÓIDE
(57) VALVULA SOLENÓIDE. A presente invenção refere-se a válvulas
solenóldes para utilização em um sistema de partida a frio para um motor de
combustão interna a etanol e/ou do tipo flex ou multi-combustível. A válvula
solenóide é uma válvula de alta pressão cujo membro de núcleo é fabricado a
partir de um material de alto magnetismo, cilíndrico, compreendendo uma
porção de membro de núcleo fixo e uma porção de membro de núcleo móvel
centralmente posicionadas no interior da bobina do solenóide e carregadas por
uma mola, as extremidades próximas da porção de membro de núcleo fixo e da
porção de membro de núcleo móvel sendo formadas com uma porção em
recesso tendo um di&metro menor que o das porções de corpo do núcleo cujos
limites definem batentes para as extremidades da referida mola.
(71) INDEBRÁS Indústria Eletromecânica Brasileira Ltda (BR/SP)
(72) Jayme Roberto Vargas da Silva
(74) Martinez & Moura Barreto S/S Ltda
RPI 2109 de 07/06/2011
(21) PI 0903998-8 A2 (22) 07/10/2009
3.1
(51) C07K 16/12 (2006.01), G01N 33/18 (2006.01)
(54) MÉTODO PARA DETECÇÃO DE MICROCISTINAS E/OU NODULARINA
EM AMOSTRAS AMBIENTAIS; KIT DE DIAGNÓSTICO, ANTICORPO
POLICLONAL PARA DETECÇÃO DE MICROCISTINAS E/OU NODALARINA
EM AMOSTRAS AMBIENTAIS E MÉTODO DE PRODUÇÃO DO REFERIDO
ANTICORPO POLICLONAL
(57) MÉTODO PARA DETECÇÃO DE MICROCISTINAS E/OU NODULARINA
EM AMOSTRAS AMBIENTAIS; KIT DE DIAGNÓSTICO, ANTICORPO
POLICLONAL PARA DETECÇÃO DE MICROCISTINAS E/OU NODALARINA
EM AMOSTRAS AMBIENTAIS E MÉTODO DE PRODUÇÃO DO REFERIDO
ANTICORPO POLICLONAL. A presente invenção se refere a um Método de
detecção de microcistinas e/ou nodalarina em amostras ambientais
compreendendo as etapas de sensibilizar placas de microtitulação com o
antígeno MCLR; bloquear as placas com solução de caseína 2,5%; produzir a
formação de um imunocomplexo; adicionar 100 µl do imunocomplexo formado
na etapa (iii) a microplaca bloqueada; adicionar conjugado anti-IgG marcado
com peroxidase e revelar a reação com substrato OPD. A presente invenção
refere-se ainda a produção de um kit de diagnóstico para a detecção de
microcistinas e/ou nodularina utilizando o referido método.
(71) Universidade de São Paulo - USP (BR/SP) , Fundação de Amparo a
Pesquisa do Estado São Paulo - FAPESP (BR/SP)
(72) ERNANI PINTO, FABYANA MARIA DOS ANJOS, ADELAIDE JOSÉ VAZ,
NOELI MARIA ESPÍNDOLA
(74) Maria Aparecida de Souza
(21) PI 0904010-2 A2 (22) 01/10/2009
3.1
(51) A61K 36/9062 (2006.01), A61P 21/02 (2006.01), A61P 29/00 (2006.01)
(54) COMPOSIÇÃO FARMACÊUTICA E SEU USO
(57) COMPOSIÇÃO FARMACÊUTICA E SEU USO. Refere-se a matéria
técnica da presente invenção a uma composição farmacêutica compreendendo,
como princípio ativo, substâncias obtidas por meio da extraçào e purificação do
óleo essencial de espécie vegetal do gênero AlpiniLa. Mais especificamente, tal
composição pode ser utilizada nos tratamentos das hipertonias na Síndrome
Piramidal, tratamentos pulmonares por broncodílatação pulmonar e eliminação
de rugas de expressão. Uma segunda concretização consiste no uso da
composição farmacêutica na preparação de um medicamento para o tratamento
de tais hípertonías e para o tratamento estético.
(71) Hebron Farmacêutica - Pesquisa, Desenvolvimento e Inovação
Tecnologica Ltda. (BR/SP) , Instituto de Tecnologia e Pesquisa - ITP (BR/SE)
(72) Lauro Xavier Filho, Edna Aragão Farias Cândido
(74) Ana Cristina Müller Wegmann
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos 121
(21) PI 0904013-7 A2 (22) 02/10/2009
3.1
(51) E03C 1/12 (2006.01), E03C 1/16 (2006.01)
(54) REAPROVEITAMENTO DE ÁGUA DO LAVATÓRIO PARA A CAIXA DE
DESCARGA
(57) REAPROVEITAMENTO DE ÁGUA DO LAVATÓRIO PARA A CAIXA DE
DESCARGA. Trata-se de um sistema de reaproveitamento da água do lavatório
que seria descartada, para a caixa de descarga. E um sistema ecologicamente
correto, que tem como vantagens a manutenção do ecossistema. Consiste na
ligação da tubulação de saída d'água do lavatório a uma caixa de descarga
especialmente preparada, que pode ser constituída de material cerâmico,
esmaltado, plástico ou similar e, tem como propósito atender a uma demanda
de mercado que exige, cada vez mais, produtos que apresentem soluções
responsáveis a fim de preservar o meio ambiente.
(71) Alberto Déde Freire (BR/MG) , Priscila Saraiva Déde Freire (BR/MG)
(72) Alberto Déde Freire, Priscila Saraiva Déde Freire
(21) PI 0904016-1 A2 (22) 02/10/2009
3.1
(30) 02/10/2008 EP 08253215.1
(51) A61K 9/70 (2006.01), A61K 31/27 (2006.01), A61K 31/137 (2006.01)
(54) SISTEMA DE LIBERAÇÃO TRANSDÉRMICA DE FÁRMACOS PARA
COMPONENTE ATIVO LÍQUIDO
(57) SISTEMA DE LIBERAÇÃO TRANSDÉRMICA DE FÁRMACOS PARA
COMPONENTE ATIVO LÍQUIDO. A presente invenção refere-se a um
dispositivo monolítico para administração transdérmica de um componente
farmacêutico ativo que é selecionado das propargilaminas e a rivastigmina e é
líquido a 25 ºG, possui uma camada matriz adesiva que inclui o componente
ativo em um adesivo de polimero acrílico sensível à pressão sem agente
reticulador contendo um átomo metálico, o adesivo possuindo um valor de
cisalhamento entre 1,5 e 15 horas, e adicionaímente inclui um coadjuvante nãovolátil selecionado de esqualeno e citrato de trietila presente na camada em
uma quantidade de 1% a 15 % em peso. A combinação fornece boa liberação
do fármaco durante o uso, reduz a perda do fármaco durante uma etapa de
secagem na produ- ção, reduz a interação química da camada com o fármaco e
atinge um baixo nível de irritação da pele.
(71) AMARIN TECHNOLOGIES S.A (AR)
(72) PAULA FORLANO, ALEJANDRO SCASSO, FRANCISCO STEFANO
(74) Dannemann ,Siemsen, Bigler & Ipanema Moreira
(21) PI 0904018-8 A2 (22) 01/10/2009
3.1
(51) E04B 2/58 (2006.01)
(54) PAINÉIS PRÉ-FABRICADOS E PROCESSO PARA CONSTRUÇÃO DE
MORADIAS OU EDIFICAÇÕES MODULARES
(57) PAINÉIS PRE-FABRICADOS E PROCESSO PARA CONSTRUÇÃO DE
MORADIAS OU EDIFICAÇÕES MODULARES. Painéis pré-fabricados e
processo para construção de moradias ou edificações modulares com os
referidos painéis, com canaletas verticais (2), dispostas em suas bordas laterais
e pontos intermediários de união com outros painéis, as quais percorrem
verticalmente sua dimensão e, quando unidos determinam ocos (3) aptos para
serem recheados com concreto, existindo, nas canaletas verticais (2) armações
de aço em forma de U (4) que emergem parcialmente ficando embebidos no
referido concreto. Para sua fixação a concretagem (5) são providos, em pontos
coincidentes com os ocos (3), ferros (6) que emergem do concreto,
preferencialmente, uma prolongação da armação dos pilotis (7) . Além disso,
incorporam um sistema de grampos com ângulos de amarração (8), que
surgem por sua borda superior, para fixar a cobertura (9) mediante suas dobras
de seus segmentos (10).
(71) Corpus Consulting & Services, S.L. (ES)
(72) José Fernando Tórtola Bono
(74) Vieira de Mello Advogados
122
DIRPA - Notificação - Fase Nacional - PCT e Publicação de Pedidos
RPI 2109 de 07/06/2011
óleos vegetais, combustíveis, álcool, etc. (6); etapa fisico química (7); etapa
biológica (8), caracterizada por ser constituída por empresa modelo (2), a qual
no tratamento de efluentes industriais (5), o mesmo passa por uma série de
etapas, desde sua captação até o descarte final, sendo que na captação, todos
os pontos de coleta são direcionados para um tanque vertical (9), no qual o óleo
por decantação sofre a primeira separação, sendo ela, uma fase aquosa (10) e
uma fase oleosa (11). O tanque deve estar provido de um conjunto de agitador
(12) e dosador (13) de ácido sulfúrico para correção do pH que deve estar em
tomo de 11,00, sendo que na seqtiência e com o auxilio de uma moto-bomba
(14), cada porção é encaminhada para um tanque (15) específico com agitador
(12), sendo a porção aquosa tratada por batelada (16) e passado por dois tipos
de tratamento o fisico - químico (7) e o biológico (8).
(71) Plínio Pestana Pinho (BR/PR)
(72) Plínio Pestana Pinho
(74) Marcelo Henrique Zanoni
3.2
PUBLICAÇÃO ANTECIPADA
(21) PI 0905455-3 A2 (22) 07/12/2009
3.2
(51) C02F 1/40 (2006.01)
(54) PROCESSO DE TRATAMENTO DE EFLUENTE INDUSTRIAL
(57) PROCESSO DE TRATAMENTO DE EFLUENTE INDUSTRIAL. A presente
Patente de Invenção diz respeito a o Processo de Tratamento de Efluente
Industrial, (1), é caracterizado por ser constituído por empresa modelo (2) com
aluguel de tanques (3) e logística de movimentação (4); efluente industrial (5);
Diretoria de Patentes - DIRPA
Despachos Relativos a Pedidos, Patentes
(incluindo as de MI/DI expedidas na vigência da Lei
5772/71) e Certificados de Adição de Invenção
RPI 2109 de 07/06/2011
1. Pedido Internacional PCT/BR
Designado ou Eleito
1.3.1
RETIFICAÇÃO
(21) PI 0707481-6 A2 (22) 02/02/2007 1.3.1
(30) 03/02/2006 US 60/765,449; 26/07/2006 US
60/833,533; 12/10/2006 US 60/851,282
(51) A61F 2/06 (2006.01)
(54) SISTEMA DE COLOCAÇÃO E MÉTODO DE
AUTO-CENTRAGEM DE UMA EXTREMIDADE
PROXIMAL DE UM IMPLANTE DE STENT
(57) SISTEMA DE INTEGRAÇÃO E MÉTODO DE
AUTO-CENTRAGEM DE UMA EXTREMIDADE
PROXIMAL DE UM IMPLANTE DE SONDA Um
método para implantar de forma centralizada uma
prótese dentro de um lúmen curvado que inclui o
carregamento de uma prótese em um invólucro de
integração, inserir o invólucro em um paciente em
direção ao lúmen curvado para colocar pelo menos
a extremidade proximal da prótese dentro do lúmen
curvado, e centralizar a extremidade proximal da
prótese e/ou a extremidade distal do invólucro
dentro do lúmen curvado. Em uma primeira etapa de
introdução, o cateter exterior contendo o invólucro
interno é introduzido junto em direção ao lúmen
curvado para uma posição proximal do lúmen
curvado, e em uma segunda etapa de introdução, o
invólucro interno contendo a prótese é introduzido
no lúmen curvado para colocar pelo menos a
extremidade proximal dentro do lúmen curvado
enquanto o cateter externo permanece
substancialmente na posição. Após a centralização,
a extremidade proximal da prótese é disposta de
forma centralizada dentro do lúmen curvado.
(71) Bolton Medical, INC. (US)
(72) Michael Moore, Samuel Arbefeuille, Humberto
Berra, Gerry Ouellette, Frank Borrego, Fletcher
Christian, Timothy Lostetter
(74) M C Araújo Consultoria em Prop Indl Ltda
(85) 04/08/2008
(86) PCT US2007/002824 de 02/02/2007
(87) WO 2007/092276 de 16/08/2007
Referente a RPI n° 2104 de 03/05/2011 , quanto ao
ítem ( 54) .
2. Depósito
2.1
NOTIFICAÇÃO DE DEPÓSITO
DE PEDIDO DE PATENTE OU DE
CERTIFICADO DE ADIÇÃO DE
INVENÇÃO
(21) MU 9001761-7 U2 (22) 14/10/2010 2.1
(71) Gilmar Zanini (BR/SC) , Rogério Damiani Neves
(BR/SC)
(74) Anel Marcas e Patentes Ltda.
(21) MU 9001762-5 U2 (22) 14/10/2010 2.1
(71) Ari Conte (BR/RS)
(74) Marca Brazil Marcas e Patentes LTDA
(21) MU 9001763-3 U2 (22) 11/10/2010 2.1
(71) Edson Roberto Basso (BR/RS)
(74) Acerti - Marcas e Patentes Ltda
(21) MU 9001764-1 U2 (22) 15/10/2010 2.1
(71) Josemar Souza dos Santos (BR/RS)
(74) Patricia Payeras Suman
(21) MU 9001765-0 U2 (22) 15/09/2010 2.1
(71) Az4 Displays Ind. e Com. Ltda (BR/SP)
(74) Britânia Marcas e Patentes Ltda
(21) MU 9001766-8 U2 (22) 24/09/2010 2.1
(71) Osvaldo Stanescou (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) MU 9001768-4 U2 (22) 05/11/2010 2.1
(71) Ricardo Gramignia (BR/SP)
(21) MU 9001769-2 U2 (22) 24/08/2010 2.1
(71) Domingos de Oliveira Savi Mundo (BR/SC)
(74) Catiane Zini Borela
(21) MU 9001770-6 U2 (22) 07/06/2010 2.1
(71) Alexandre Verone (BR/RS)
(21) MU 9001771-4 U2 (22) 31/08/2010 2.1
(71) Esmerai Martins da Silva (BR/PE)
(74) Francisco Leite de Oliveira Filho
(21) PI 0914276-2 A2 (22) 18/12/2009 2.1
(71) WHIRLPOOL S.A. (BR/SP)
(74) LUIZ FERNANDO VILLELA NOGUEIRA
(21) PI 1002031-4 A2 (22) 28/05/2010 2.1
(71) Bellota Herramientas, S.A. (ES)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
(21) PI 1003532-0 A2 (22) 02/09/2010 2.1
(71) Wonderland Nurserygoods Company Limited
(HK)
(74) Trench, Rossi e Watanabe
(21) PI 1003533-8 A2 (22) 15/09/2010 2.1
(71) Kidde Technologies, Inc. (US)
(74) Momsen Leonardos & Cia
(21) PI 1003534-6 A2 (22) 16/09/2010 2.1
(71) CMPC Celulose Riograndense Ltda. (BR/RS)
(74) Roberto Pernold Vieira de Mello
(21) PI 1003535-4 A2 (22) 22/07/2010 2.1
(71) Fumajet Comercio de Equipamentos Ltda
(BR/RJ)
(74) Célia Novaes & Associados S/C Ltda
(21) PI 1003536-2 A2 (22) 16/09/2010 2.1
(71) Peter Michael Frohnknecht (BR/RJ)
(21) PI 1003537-0 A2 (22) 03/09/2010 2.1
(71) Oxiteno S.A. Indústria e Comércio (BR/SP)
(74) Momsen Leonardos & Cia
(21) PI 1003538-9 A2 (22) 08/09/2010 2.1
(71) Evonik Goldschmidt Gmbh (DE)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 1003539-7 A2 (22) 22/09/2010 2.1
(71) Truetzschler GMBH & CO. KG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003540-0 A2 (22) 03/09/2010 2.1
(71) R. Gonçalves Suprimentos Médicos Ltda
(BR/SP) , José Eduardo Domingues (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003541-9 A2 (22) 27/09/2010 2.1
(71) Ivan Félix Madeira (BR/MG)
(74) CGM Assessoria Ltda
(21) PI 1003561-3 A2 (22) 17/09/2010 2.1
(71) Universidade Federal de Uberlândia (BR/MG) ,
Fundação de Amparo a Pesquisa do Estado de
Minas Gerais (BR/MG)
(21) PI 1003562-1 A2 (22) 15/09/2010 2.1
(71) Universidade Federal do Rio Grande do Sul
(BR/RS)
(21) PI 1003563-0 A2 (22) 28/09/2010 2.1
(71) Voith Patent GMBH (DE)
(74) Guerra Propriedade Industrial
(21) PI 1003564-8 A2 (22) 28/09/2010 2.1
(71) MARCIO HOWE (BR/RS)
(74) Marcas Brazil Marcas e Patentes Ltda
(21) PI 1003565-6 A2 (22) 23/09/2010 2.1
(71) Glodea, Limited Liability Company (US)
(74) Felippe Guilherme Keske
(21) PI 1003566-4 A2 (22) 17/09/2010 2.1
(71) Roseane de Paula Lima (BR/MG)
(21) PI 1003567-2 A2 (22) 03/09/2010 2.1
(71) Fabio Cesar Maia (BR/CE)
(74) Impar Agencia da Propriedade Industrial Ltda
(21) PI 1003568-0 A2 (22) 29/10/2010 2.1
(71) Log On Multimídia Ltda. (BR/SP)
(74) Natan Baril
(21) PI 1003569-9 A2 (22) 08/10/2010 2.1
(71) ArcelorMittal Brasil S.A. (BR/ES)
(74) Wagner José Fafa Borges
(21) PI 1003570-2 A2 (22) 14/10/2010 2.1
(71) Marco Aurélio Ronchi (BR/SC)
(74) Anel Marcas e Patentes Ltda.
(21) PI 1003571-0 A2 (22) 13/10/2010 2.1
(71) Jair Hamann (BR/SC)
(74) Edemar Soares Antonini
(21) PI 1003572-9 A2 (22) 15/10/2010 2.1
(71) Mueller Fogões Ltda. (BR/SC)
(74) Pap Marcas e Patentes Ltda.
(21) PI 1003573-7 A2 (22) 15/10/2010 2.1
(71) Sulmaq Industrial e Comercial S.A (BR/RS)
(74) Lealvi Marcas e Patentes Ltda
(21) PI 1003574-5 A2 (22) 14/10/2010 2.1
(71) Glauber Reinicke Brozoza (BR/RS)
(74) Marca Brazil Marcas e Patentes LTDA
124
DIRPA - Despachos Relativos a Pedidos e Patentes
(21) PI 1003575-3 A2 (22) 05/10/2010 2.1
(71) Germano José Botoluzzi (BR/RS)
(74) Capella & Veloso Associados Ltda.
(21) PI 1003576-1 A2 (22) 29/10/2010 2.1
(71) KuoTsung-Hsien (TW)
(74) Milton Lucídio Leão Barcellos
(71) Johnson & Johnson Industria e Comércio Ltda
(BR/SP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003598-2 A2 (22) 15/09/2010 2.1
(71) Abb Technology Ag (CH)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 1003577-0 A2 (22) 27/09/2010 2.1
(71) Bizmaq Indústria de Implementos Agroflorestal
Ltda - ME (BR/ES)
(74) Wagner José Fafa Borges
(21) PI 1003599-0 A2 (22) 23/09/2010 2.1
(71) Siemens Industry, Inc. (US)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 1003578-8 A2 (22) 09/07/2010 2.1
(71) Giuseppe Valduga Cruz (BR/SC)
(74) Nivan Paulo Minguranse
(21) PI 1003600-8 A2 (22) 03/09/2010 2.1
(71) Xerox Corporation (US)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 1003580-0 A2 (22) 17/09/2010 2.1
(71) Everton Furlani (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003601-6 A2 (22) 28/09/2010 2.1
(71) Evonik Degussa GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003581-8 A2 (22) 17/09/2010 2.1
(71) Ellman International, INC. (US)
(74) Dannemann , Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003582-6 A2 (22) 17/09/2010 2.1
(71) Ouro Fino Participações e Empreendimentos
S/A (BR/SP)
(74) Atem e Remer Asses. Consult. Prop. Int. LTDA
(21) PI 1003583-4 A2 (22) 09/09/2010 2.1
(71) Deere & Company (US)
(74) Momsen, Leonardos & Cia
(21) PI 1003584-2 A2 (22) 03/09/2010 2.1
(71) Marcon Indústria Metalúrgica Ltda (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003585-0 A2 (22) 03/09/2010 2.1
(71) Ivan Feres (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003586-9 A2 (22) 10/09/2010 2.1
(71) Petroleo Brasileiro S.A. - Petrobras (BR/RJ)
(21) PI 1003587-7 A2 (22) 02/09/2010 2.1
(71) The Goodyear Tire & Rubber Company (US)
(74) Nellie Anne Daniel - Shores
(21) PI 1003588-5 A2 (22) 24/09/2010 2.1
(71) Evonik Goldschmidt GMBH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003602-4 A2 (22) 30/09/2010 2.1
(71) GM Global Technology Operation INC (US)
(74) Momsen, Leonardos & CIA
(21) PI 1003603-2 A2 (22) 20/09/2010 2.1
(71) Deere & Company (US)
(74) Momsen, Leonardos & CIA.
(21) PI 1003604-0 A2 (22) 21/09/2010 2.1
(71) José Ronaldo Cavalcante de Souza (BR/SP)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003605-9 A2 (22) 10/09/2010 2.1
(71) Seb S.A (FR)
(74) Araripe & Associados
(21) PI 1003606-7 A2 (22) 10/09/2010 2.1
(71) National Machinery Llc (US)
(74) Nellie Anne Danie-Shores
(21) PI 1003607-5 A2 (22) 23/09/2010 2.1
(71) Insituto Nacional de Pesquisas da Amazônia INPA (BR/AM)
(74) Atem e Remer Asses. Consult. Prop. Int. Ltda
(21) PI 1003608-3 A2 (22) 20/09/2010 2.1
(71) Homilton Marincek Filho (BR/SP)
(21) PI 1003609-1 A2 (22) 27/09/2010 2.1
(71) Elc Produtos de Segurança Indústria e
Comércio Ltda (BR/RJ)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003589-3 A2 (22) 23/09/2010 2.1
(71) Honda Motor CO., LTD. (JP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003610-5 A2 (22) 30/09/2010 2.1
(71) Fhf Funke + Huster Fernsig Gmbh (DE)
(74) Maria Pia Carvalho Guerra
(21) PI 1003590-7 A2 (22) 17/09/2010 2.1
(71) Sony Corporation (JP)
(74) Momsen, Leonardos & Cia.
(21) PI 1003611-3 A2 (22) 29/09/2010 2.1
(71) Galdino Ivo Garcia (BR/SC)
(74) Galdino Ivo Garcia
(21) PI 1003591-5 A2 (22) 16/09/2010 2.1
(71) Makita Corporation (JP)
(74) Araripe & Associados
(21) PI 1003612-1 A2 (22) 30/09/2010 2.1
(71) Lang-Mekra North America, LLC (US)
(74) Momsen, Leonardos & CIA
(21) PI 1003592-3 A2 (22) 09/09/2010 2.1
(71) Sony Corporation (JP)
(74) Momsen, Leonardos & Cia
(21) PI 1003613-0 A2 (22) 23/09/2010 2.1
(71) Babcock & Wilcox Power Generation Group,
INC. (US)
(74) Nellie Anne Daniel-Shores
(21) PI 1003593-1 A2 (22) 14/09/2010 2.1
(71) Xerox Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003594-0 A2 (22) 20/09/2010 2.1
(71) Whirlpool S.A. (BR/SP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003595-8 A2 (22) 15/09/2010 2.1
(71) Satisloh AG (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003596-6 A2 (22) 15/09/2010 2.1
(71) Robert Bosch Limitada (BR/SP)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 1003597-4 A2 (22) 02/09/2010 2.1
(21) PI 1003614-8 A2 (22) 30/09/2010 2.1
(71) GM Global Technology Operation INC (US)
(74) Momsen, Leonardos & CIA
(21) PI 1003615-6 A2 (22) 08/09/2010 2.1
(71) Voith Patent Gmbh (DE)
(74) Diego Goulart de Oliveira Vieira
(21) PI 1003616-4 A2 (22) 10/09/2010 2.1
(71) Sony Corporation (JP)
(74) Momsen, Leonardos & Cia
(21) PI 1003617-2 A2 (22) 29/09/2010 2.1
(71) Fung Gin da Energy Science And Technology
Co., Ltd (TW)
(74) Nellie Anne Daniel-Shores
(21) PI 1003618-0 A2 (22) 16/09/2010 2.1
(71) Honda Motor CO., Ltd. (JP)
RPI 2109 de 07/06/2011
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003619-9 A2 (22) 20/09/2010 2.1
(71) Luiz Antonio da Silva (BR/ES)
(74) Vilage Marcas & Patentes S/S Ltda
(21) PI 1003620-2 A2 (22) 03/09/2010 2.1
(71) Ouro Fino Participações e Empreendimentos
S/A (BR/SP)
(74) Atem e Remer Asses. Consult. Prop. Int. Ltda
(21) PI 1003621-0 A2 (22) 09/09/2010 2.1
(71) Scania Cv Ab (SE)
(74) Nellie Anne Danie-Shores
(21) PI 1003622-9 A2 (22) 27/09/2010 2.1
(71) The Goodyear Tire & Rubber Company (US)
(74) Nellie Anne Daniel-Shores
(21) PI 1003623-7 A2 (22) 25/01/2010 2.1
(71) Universidade Federal de São Paulo - Unifesp
(BR/SP)
(74) Atem e Remer Asses. Consult. Prop. Int. Ltda
(21) PI 1003639-3 A2 (22) 22/09/2010 2.1
(71) Sony Corporation (JP)
(74) Momsen, Leonardos & Cia.
(21) PI 1003640-7 A2 (22) 21/09/2010 2.1
(71) Samsung Electro-Mecanics CO., LTD. (KR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003641-5 A2 (22) 21/09/2010 2.1
(71) Arvinmeritor Technology, LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003642-3 A2 (22) 27/09/2010 2.1
(71) Johnson & Johnson Consumer Companies, INC
(US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 1003643-1 A2 (22) 23/09/2010 2.1
(71) Amsted Rail Company, INC. (US)
(74) Momsen, Leonardos & Cia.
(21) PI 1003644-0 A2 (22) 27/09/2010 2.1
(71) Mizuno Corporation (JP)
(74) Momsen, Leonardos & CIA.
(21) PI 1003645-8 A2 (22) 09/09/2010 2.1
(71) Universidade Estadual de Londrina (BR/PR)
(74) Marinete Violin
(21) PI 1003646-6 A2 (22) 08/09/2010 2.1
(71) Embrapa - Empresa Brasileira de Pesquisa
Agropecuária. (BR/DF)
(74) Chang das Estrelas Wilches
(21) PI 1003667-9 A2 (22) 11/08/2010 2.1
(71) Mara Gabriela Novy Quadri (BR/SC)
2.4
NOTIFICAÇÃO DE DEPÓSITO
DO PEDIDO DIVIDIDO
(21) PI 9715372-9 A2 (22) 16/12/1997 2.4
(62) PI9706363-0 16/12/1997
(71) Hitachi, Ltd. (JP)
(74) Momsen, Leonardos & Cia.
Publicação de pedido de patente(3.1):RPI
1590(26/06/2001); Alteração da Classificação
(15.11) : RPI 2075 (13/10/2010); Conhecimento do
parecer técnico(7.1): RPI 2077 (26/10/2010)
(21) PI 9715373-7 A2 (22) 16/12/1997 2.4
(62) PI9706363-0 16/12/1997
(71) Hitachi, Ltd. (JP)
(74) Momsen, Leonardos & Cia.
Publicação de pedido de patente(3.1):RPI
1590(26/06/2001); Alteração da Classificação
(15.11) : RPI 2075 (13/10/2010); Conhecimento do
parecer técnico(7.1): RPI 2077 (26/10/2010)
(21) PI 0117325-1 A2 (22) 20/09/2001 2.4
(62) PI0114007-8 20/09/2001
(71) Sanofi-Aventis (FR)
RPI 2109 de 07/06/2011
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Notificação da entrada da Fase Nacional (1.3):RPI
1701 (12/08/2003); Transferência deferida (25.1):
RPI 1839(04/04/2006); Alteração de nome (25.4):
RPI 1841(18/04/2006); Conhecimento do parecer
técnico (7.1): RPI's 2035 (05/01/2010) e
2072(21/09/2010)
2.7
REPUBLICAÇÃO(*)
(21) PI 1003348-3 A2 (22) 03/09/2010 2.7
(71) Katiuscia Viviane Liesenberg (BR/SC) , Fabiane
Celuppi (BR/SC)
(74) Sandro Conrado da Silva
Referente à RPI 2107 de 24/05/11, cód. 2.1, quanto
ao Nome do Depositante (71)
3. Publicação do Pedido
3.7
PUBLICAÇÃO ANULADA
(21) PI 0803390-0 A2 (22) 18/08/2008 3.7
(30) 20/09/2007 US 60/960,211; 29/05/2008 US
12/155,117
(51) B29B 17/02 (2006.01), B03B 9/06 (2006.01)
(54) COMPOSIÇÃO DE FIBRA SINTÉTICA COM
FILAMENTOS DE TAPETE RECUPERADO PÓSCONSUMIDOR E RESPECTIVOS PROCESSOS
DE PRODUÇÃO
(71) Universal Fibers, Inc. (US)
(72) George Taylor Hoover, Jr., Milton Keith Roark,
Brendan Francis Mcsheehy, JR., Matthew Benjamin
Studholme
(74) Hugo Silva, Rosa & Maldonado-Prop. Int
Referente a RPI 2089 de 18/01/2011.
6. Exigências Técnicas e
Formais
6.1
EXIGÊNCIA - ART. 36 DA LPI
(21) MU 8203390-0 U2 (22) 21/10/2002 6.1
(71) Mueller Fogões LTDA. (BR/SC)
(74) Paulo Afonso Pereira Cons. em Marcas e
Patentes LTDA.
(21) MU 8302352-6 U2 (22) 22/08/2003 6.1
(71) Antonio Carlos Montanha Vianna (BR/PR)
(74) A Criativa Marcas e Patentes S/C LTDA
(21) MU 8303396-3 U2 (22) 01/12/2003 6.1
(71) A. Guerra S.A. - Implementos Rodoviários
(BR/RS)
(74) Luiz Fernando Campos Stock
(21) PI 0306945-1 A2 (22) 13/11/2003 6.1
(71) Universidade Estadual de Campinas UNICAMP (BR/SP)
(74) Maria Cristina Valim Lourenço Gomes
(21) PI 0307476-5 A2 (22) 02/02/2003 6.1
(71) Volvo Lastvagnar AB (SE)
(74) Thomaz Thedim Lobo
(21) PI 0308716-6 A2 (22) 21/03/2003 6.1
(71) Knorr-Bremse Systeme Fur Nutzfahrzeuge
GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0309141-4 A2 (22) 17/03/2003 6.1
(71) K-Tron Technologies, INC. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0309313-1 A2 (22) 17/04/2003 6.1
(71) Airbus Deutschland Gmbh (DE)
DIRPA - Despachos Relativos a Pedidos e Patentes 125
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0309469-3 A2 (22) 22/04/2003 6.1
(71) MDI Motor Development International S.A. (LU)
(74) Dannemann , Siemsen, Bigler & Ipanema
Moreira
(21) PI 0311550-0 A2 (22) 20/05/2003 6.1
(71) International Engine Intellectual Property
Company, LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0311638-7 A2 (22) 06/06/2003 6.1
(71) Microban Products Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0313785-6 A2 (22) 22/08/2003 6.1
(71) Bombardier Transportation Gmbh (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0314744-4 A2 (22) 10/10/2003 6.1
(71) Hendrickson International Corporation (US)
(74) Nellie Anne Daniel Shores
(21) PI 0314805-0 A2 (22) 24/09/2003 6.1
(71) Kongsberg Automotive ASA (NO)
(74) Matos e Associados - Advogados
(21) PI 0315697-4 A2 (22) 13/11/2003 6.1
(71) Industeel Creusot (FR)
(74) Paola Calabria Mattioli
(21) PI 0501337-2 A2 (22) 13/04/2005 6.1
(71) Claas Selbstfahrende Erntemaschinen GMBH
(DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0501348-8 A2 (22) 18/04/2005 6.1
(71) Semeato S/A Indústria e Comércio (BR/RS)
(74) Gabriela C. S. Pretto
(21) PI 9902623-6 A2 (22) 24/06/1999 6.1
(71) DSM IP Assets B.V. (NL)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9910382-6 A2 (22) 11/05/1999 6.1
(71) UBIQ Incorporated (US)
(74) Momsen, Leonardos & CIA.
(21) PI 9911300-7 A2 (22) 11/06/1999 6.1
(71) University Leiden (NL) , N.V. Organon (NL)
(74) Momsen, Leonardos & Cia.
(21) PI 9914622-3 A2 (22) 11/10/1999 6.1
(71) Thomson Multimedia (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9917586-0 A2 (22) 17/12/1999 6.1
(71) Agrofresh, INC. (US)
(74) Momsen , Leonardos & CIA.
(21) PI 9917766-8 A2 (22) 30/04/1999 6.1
(62) PI9915970-8 30/04/1999
(71) Schering-Plough Ltd. (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0001627-6 A2 (22) 17/04/2000 6.1
(71) Sumitomo Chemical Company, Limited (JP)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0005786-0 A2 (22) 16/11/2000 6.1
(71) Dow Corning Toray Silicone Company, Ltd (JP)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0106110-0 A2 (22) 12/12/2001 6.1
(71) Illinois Tool Works, INC. (US)
(74) Nellie Anne Daniel Shores
(21) PI 0108657-0 A2 (22) 21/02/2001 6.1
(71) UCB Farchim S.A. (CH)
(74) Momsen, Leonardos & Cia.
(21) PI 0111158-2 A2 (22) 10/05/2001 6.1
(71) Genzyme Corporation (US)
(74) Paulo Sérgio Scatamburlo
(21) PI 0111239-2 A2 (22) 22/05/2001 6.1
(71) MG Technologies AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0111277-5 A2 (22) 23/05/2001 6.1
(71) Mauser-Werke GMBH & CO KG. (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0113727-1 A2 (22) 07/09/2001 6.1
(71) Dow Agrosciences LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0114576-2 A2 (22) 05/10/2001 6.1
(71) Smithkline Beecham P.L.C. (GB)
(74) Momsen, Leonardos & Cia.
(21) PI 0114812-5 A2 (22) 13/09/2001 6.1
(71) Shanghai Institute of Organic Chemistry,
Chinese Academy of Sciences (CN) , Zhejiang
Chemical Industry Research Institute (CN)
(74) Marcello do Nascimento
(21) PI 0115224-6 A2 (22) 17/10/2001 6.1
(71) Celanese International Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0115964-0 A2 (22) 23/11/2001 6.1
(71) DSM IP Assets B.V. (NL)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0116094-0 A2 (22) 10/12/2001 6.1
(71) Unilever N.V. (NL)
(74) Atem & Remer Asses. Consul. Prop. Int. Ltda
(21) PI 0116130-0 A2 (22) 12/12/2001 6.1
(71) Meadwestvaco Packaging Systems, LLC (US)
(74) Momsen, Leonardos & Cia
(21) PI 0116204-7 A2 (22) 12/11/2001 6.1
(71) Ciba Specialty Chemicals Holding INC. (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0116242-0 A2 (22) 18/12/2001 6.1
(71) Aisapack Holding SA (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0116588-7 A2 (22) 18/12/2001 6.1
(71) Unilever N.V. (NL)
(74) Atem & Remer Assessoria e Consultoria de
Propriedade Intelectual Ltda.
(21) PI 0200751-7 A2 (22) 06/02/2002 6.1
(71) Universidade Federal de Minas Gerais (BR/MG)
(21) PI 0202967-7 A2 (22) 29/07/2002 6.1
(71) Institut Francais Du Petrole (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0203404-2 A2 (22) 27/08/2002 6.1
(71) LG Electronics INC. (KR)
(74) Nellie Anne Daniel Shoes
(21) PI 0204709-8 A2 (22) 19/11/2002 6.1
(71) Petroleo Brasileiro S.A. - PETROBRAS (BR/RJ)
(74) Antonio Claudio Correa Meyer Sant'Anna
(21) PI 0204734-9 A2 (22) 21/10/2002 6.1
(71) Universidade Estadual de Campinas UNICAMP (BR/SP) , Fundação de Amparo à
Pesquisa do Estado de São Paulo - FAPESP
(BR/SP)
(74) Maria Cristina Valim Lourenço Gomes
6.6
EXIGÊNCIA - ART. 34 DA LPI
(21) PI 9708566-9 A2 (22) 11/04/1997 6.6
(71) 1149336 Ontario, INC. (CA) , NPS
Pharmaceuticals, Inc. (US)
(74) Momsen, Leonardos & Cia.
(21) PI 0013493-7 A2 (22) 24/08/2000 6.6
(71) Takeda Pharmaceutical Company Limited (JP)
(74) Momsen, Leonardos & Cia
126
DIRPA - Despachos Relativos a Pedidos e Patentes
6.7
OUTRAS EXIGÊNCIAS
(21) PI 0300182-2 A2 (22) 23/01/2003 6.7
(71) Jefferson Beles Gonçales (BR/SP)
(74) Logos Marcas e Patentes S/C Ltda
Para que seja aceita petição 018100011978 de
07/04/2010 o interessado deverá comprovar o
recolhimento referente a 7ª anuidade.
(21) PI 0316770-4 A2 (22) 12/12/2003 6.7
(71) Ashmont Holdings Limited (NZ)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Para que a solicitação de devolução de prazo seja
analisada, a mesma deverá ser apresentada ao INPI
acompanhada da cópia do pedido de fotocópia e
dos demais documentos legalmente exigíveis, de
acordo com o Art. 3º da Resolução 116/04.
(21) PI 0316996-0 A2 (22) 12/11/2003 6.7
(71) Bayer Cropscience S.A. (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Para que a solicitação de devolução de prazo seja
analisada, a mesma deverá ser apresentada ao INPI
acompanhada da cópia do pedido de fotocópia e
dos demais documentos legalmente exigíveis, de
acordo com o Art. 3º da Resolução 116/04.
(21) PI 0406875-0 A2 (22) 30/01/2004 6.7
(71) Syngenta Participations Ag (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Para que a solicitação de devolução de prazo seja
analisada, a mesma deverá ser apresentada ao INPI
acompanhada da cópia do pedido de fotocópia e
dos demais documentos legalmente exigíveis, de
acordo com o Art. 3º da Resolução 116/04.
(21) PI 9715316-8 A2 (22) 02/06/1997 6.7
(62) PI9714304-9 02/06/1997
(71) That Corporation (US)
(74) Nellie Anne Daniel Shores
Afim de atender a petição de nº020110018420 de
24/02/2011, apresente o requerente procuração
original ou cópia autenticada em cartório.
(21) PI 0111656-8 A2 (22) 07/06/2001 6.7
(71) Merial Limited (US)
(74) Ana Paula Santos Celidonio
Para que a solicitação de devolução de prazo seja
analisada, a mesma deverá ser apresentada ao INPI
acompanhada da cópia do pedido de fotocópia e
dos demais documentos legalmente exigíveis, de
acordo com o Art. 3º da Resolução 116/04.
6.9
PUBLICAÇÃO ANULADA
(21) PI 0313863-1 A2 (22) 28/08/2003 6.9
(71) Elkem ASA (NO)
(74) Momsen, Leonardos & Cia
Referente à RPI 2108
(21) PI 9805172-5 A2 (22) 10/11/1998 6.9
(71) Pial Eletro Eletrônicos Ltda (BR/SP)
(74) Antonio Mauricio Pedras Arnaud
Anulada a publicação de exigência, item 6.1 da RPI
2102 de 19/04/2011, por ter sido indevida.
7. Ciência de Parecer
7.1
CONHECIMENTO DE PARECER
TÉCNICO
(21) MU 8302149-3 U2 (22) 22/08/2003 7.1
(71) Jaime Luciano de Biagi (BR/SP)
(74) Aunimark Marcas e Patentes Ltda
(21) MU 8303139-1 U2 (22) 12/12/2003 7.1
(71) Mauro Curtolo (BR/SP)
(74) Interação Marcas e Patentes S/C LTDA.
(21) MU 8303473-0 U2 (22) 28/07/2003 7.1
RPI 2109 de 07/06/2011
(71) Serafim Felix da Silva (BR/BA)
(74) Brasnorte Marcas e Patentes
(71) Magneti Marelli S.p.A. (IT)
(74) Advocacia Pietro Ariboni S/C
(21) MU 8501805-8 U2 (22) 24/08/2005 7.1
(71) Piccin Máquinas Agrícolas Ltda. (BR/SP)
(74) Ednéa Casagrande Pinheiro
(21) PI 0014561-0 A2 (22) 12/10/2000 7.1
(71) Fmc Corporation (US)
(74) Momsen, Leonardos & Cia
(21) PI 0315425-4 A2 (22) 20/10/2003 7.1
(71) Cmte Development Limited. (AU)
(74) Dannemann Siemsen Bigler & Ipanema Moreira
(21) PI 0017198-0 A2 (22) 28/03/2000 7.1
(71) Council Of Scientific & Industrial Research (IN)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0316154-4 A2 (22) 10/11/2003 7.1
(71) National Oilwell Norway AS (NO)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0316344-0 A2 (22) 13/11/2003 7.1
(71) J.C. Bamford Excavators Limited (GB)
(74) Orlando de Souza
(21) PI 0316378-4 A2 (22) 13/11/2003 7.1
(71) Exxonmobil Oil Corporation (US)
(74) Orlando de Souza
(21) PI 9613017-2 A2 (22) 02/10/1996 7.1
(62) PI9612923-9 02/10/1996
(71) Starsight Telecast, Incorporated (US)
(74) Momsen, Leonardos & CIA.
(21) PI 9616032-2 A2 (22) 02/10/1996 7.1
(62) PI9613017-2 02/10/1996
(71) Starsight Telecast, Incorporated (US)
(74) Momsen, Leonardos & Cia.
(21) PI 9616033-0 A2 (22) 02/10/1996 7.1
(62) PI9613017-2 02/10/1996
(71) Starsight Telecast, Incorporated (US)
(74) Momsen, Leonardos & Cia.
(21) PI 9715295-1 A2 (22) 11/12/1997 7.1
(62) PI9713755-3 11/12/1997
(71) Amgen Inc. (US)
(74) Momsen, Leonardos & CIA.
(21) PI 0107799-6 A2 (22) 24/01/2001 7.1
(71) Haruo Sugiyama (JP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0108024-5 A2 (22) 17/01/2001 7.1
(71) Cadila Healthcare LTD. (IN)
(74) Martinez & Associados S/C Ltda.
(21) PI 0108216-7 A2 (22) 09/02/2001 7.1
(71) South African Nuclear Energy Corporation
Limited (ZA) , 3M Innovative Properties Company
(US)
(74) Bhering, Almeida & Associados
(21) PI 0108217-5 A2 (22) 09/02/2001 7.1
(71) South African Nuclear Energy Corporation
Limited (ZA) , 3M Innovative Properties Company
(US)
(74) Bhering, Almeida & Associados
(21) PI 0108631-6 A2 (22) 13/02/2001 7.1
(71) Sanofi-Aventis Deutschland GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0109200-6 A2 (22) 12/03/2001 7.1
(71) Actelion Pharmaceuticals LTD (CH)
(74) Momsen, Leonardos & Cia
(21) PI 9804217-3 A2 (22) 22/09/1998 7.1
(71) Fabrimar S.A. Indústria e Comércio (BR/RJ)
(74) Antonio Mauricio Pedras Arnaud
(21) PI 0110734-8 A2 (22) 11/05/2001 7.1
(71) Consejo Superior de Investigaciones Cientificas
(ES)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 9804937-2 A2 (22) 27/05/1998 7.1
(71) Kathrein-Werke KG (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0110748-8 A2 (22) 11/05/2001 7.1
(71) The Regents Of The University Of Michigan
(US)
(74) Nellie Anne Daniel Shores
(21) PI 9810297-4 A2 (22) 19/06/1998 7.1
(71) Schlumberger Resource Management Services,
INC. (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0110919-7 A2 (22) 16/05/2001 7.1
(71) Kimberly-Clark Worldwide, Inc. (US)
(74) Clarke Modet do Brasil Ltda
(21) PI 9812219-3 A2 (22) 15/09/1998 7.1
(71) Telefonaktiebolaget LM Ericsson (SE)
(74) Momsen, Leonardos & CIA.
(21) PI 9813257-1 A2 (22) 14/10/1998 7.1
(71) Panasonic Corporation (JP)
(74) Nascimento Advogados
(21) PI 9813293-8 A2 (22) 27/10/1998 7.1
(71) Sun Microsystems, Inc (US) , Opentv, Inc. (US)
(74) Momsen, Leonardos & CIA.
(21) PI 9905951-7 A2 (22) 22/12/1999 7.1
(71) Samsung Electronics Co., Ltd. (KR)
(74) Paulo C. Oliveira & Cia.
(21) PI 9910396-6 A2 (22) 07/05/1999 7.1
(71) Smithkline Beecham Biologicals S.A (BE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9915970-8 A2 (22) 30/04/1999 7.1
(71) Schering-Plough Ltd. (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9917839-7 A2 (22) 09/08/1999 7.1
(62) PI9913646-5 09/08/1999
(71) Boehringer Ingelheim (Canada) Ltd. (CA)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0009144-8 A2 (22) 26/04/2000 7.1
(21) PI 0111826-9 A2 (22) 29/05/2001 7.1
(71) Chevron U.S.A INC. (US)
(74) Momsen, Leonardos & Cia
(21) PI 0111830-7 A2 (22) 21/06/2001 7.1
(71) Wyeth Holdings Corporation (US)
(74) Momsen, Leonardos & Cia
(21) PI 0112372-6 A2 (22) 02/07/2001 7.1
(71) Johnson & Johnson (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0112394-7 A2 (22) 22/06/2001 7.1
(71) Dow Agrosciences LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0114097-3 A2 (22) 21/09/2001 7.1
(71) Engelhard Corporation (US)
(74) Trench, Rossi e Watanabe
(21) PI 0114440-5 A2 (22) 31/08/2001 7.1
(71) Allergan, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0115621-7 A2 (22) 19/11/2001 7.1
(71) Pfizer Products INC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0116124-5 A2 (22) 12/12/2001 7.1
(71) Bayer CropScience AG (DE)
RPI 2109 de 07/06/2011
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0200149-7 A2 (22) 17/01/2002 7.1
(71) Contralco (FR)
(74) Veirano E Advogados Associados
(21) PI 0201578-1 A2 (22) 23/04/2002 7.1
(71) ROGÉRIO FLORENTINO DA SILVA (BR/SP)
(74) Moras & Corrêa Marcas e Patentes S/C Ltda
(21) PI 0203256-2 A2 (22) 08/08/2002 7.1
(71) Daniela Coutinho de Castro (BR/SP)
(74) Cruzeiro/Newmarc Patentes e Marcas LTDA
(21) PI 0204450-1 A2 (22) 28/02/2002 7.1
(71) INVISTA Technologies S.à.r.l. (CH)
(74) Ana Paula Santos Celidonio
(21) PI 0206371-9 A2 (22) 19/11/2002 7.1
(71) Apr Applied Pharma Research SA (CH)
(74) Momsen, Leonardos & Cia.
(21) PI 0206658-0 A2 (22) 24/01/2002 7.1
(71) ABB Lummus Global, INC. (US)
(74) Franklin S. Ferri Escritorio de Advocacia
(21) PI 0207921-6 A2 (22) 06/03/2002 7.1
(71) Texaco Development Corporation (US)
(74) Momsen, Leonardos & Cia.
(21) PI 0208047-8 A2 (22) 29/01/2002 7.1
(71) Institut Francais Du Petrole (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0213662-7 A2 (22) 15/10/2002 7.1
(71) 3M Innovative Properties Company (US)
(74) Tinoco Soares & Filho Ltda
7.2
PUBLICAÇÃO ANULADA
(21) PI 0314334-1 A2 (22) 21/08/2003 7.2
(71) UTC Fuel Cells, LLC (US)
(74) Bhering Advogados
Referente a RPI 2108 de 31/05/2011.
(21) PI 0317758-0 A2 (22) 22/12/2003 7.2
(71) Texaco Ovonic Battery Systems LLC (US)
(74) Momsen, Leonardos & Cia
Rerefente a RPI 2108 de 31/05/2011.
8. Anuidade de Pedido
8.7
RESTAURAÇÃO
(21) PI 0303366-0 A2 (22) 04/03/2003 8.7
(71) Card Guard Scientific Survival LTD. (IL)
(74) Pinheiro Neto - Advogados
(21) PI 0307221-5 A2 (22) 24/11/2003 8.7
(71) Carrier Corporation (US)
(74) Momsen, Leonardos & Cia
(21) PI 0308360-8 A2 (22) 12/03/2003 8.7
(71) Ethypharm (FR) , Universite de Montreal (CA)
(74) Momsen, Leonardos & Cia
(21) PI 0215584-2 A2 (22) 07/02/2002 8.7
(71) Lighting Control, Inc (US)
(74) Dannemann, Siemen, Bigler & Ipanema Moreira
(21) PI 0215897-3 A2 (22) 23/10/2002 8.7
(71) Mitsubishi Rayon Co., Ltd. (JP)
(74) Cruzeiro/Newmarc Patentes e Marcas Ltda.
8.8
DESPACHO ANULADO (**)
(21) PI 0318765-9 A2 (22) 29/08/2003 8.8
(62) PI0303439-9 29/08/2003
(71) Seiko Epson Corporation (JP)
(74) Nellie Anne Daniel Shores
Referente ao despacho publicado na RPI 2029 de
24/11/2009.
DIRPA - Despachos Relativos a Pedidos e Patentes 127
(21) PI 0508044-4 A2 (22) 25/02/2005 8.8
(71) Lurgi Zimmer GmbH (DE)
(74) Claudia Christina Schulz
Referente ao despacho publicado na RPI 2099 de
29/03/2011.
(54) PROCESSO PARA FABRICAÇÃO DE AROS
BI PARTIDOS PARA RODAS EM GERAL E ARO BI
PARTIDO OBTIDO A PARTIR DESTE PROCESSO
(71) Celso Araújo (BR/SP)
(74) Vilage Marcas & Patentes S/C LTDA
8.11
MANUTENÇÃO DO
ARQUIVAMENTO
(21) PI 0303423-2 A2 (22) 25/08/2003 9.1
(54) ESTRUTURA DE PASSAGEM DE ÓLEO
PARA UM MOTOR
(71) Honda Giken Kogyo Kabushiki Kaisha (JP)
(74) Dannemann, Siemen, Bigler & Ipanema Moreira
(21) C1 9905473-6 E2 (22) 02/04/2003 8.11
(61) PI9905473-6 27/10/1999
(71) Wiliam dos Santos (BR/SP)
Referente ao despacho publicado na RPI 1888 de
13/03/2007.
(21) PI 9917265-8 A2 (22) 02/06/1999 8.11
(71) University Of Maryland (US)
(74) Toledo Corrêa Marcas e Patentes S/C Ltda.
Referente ao despacho publicado na RPI 2069 de
31/08/2010.
(21) PI 0113250-4 A2 (22) 30/07/2001 8.11
(71) H. Lundbeck A/S (DK)
(74) Momsen, Leonardos & Cia
Referente ao despacho publicado na RPI 2060 de
29/06/2010.
9. Decisão
9.1
DEFERIMENTO
(21) MU 7903370-9 U2 (22) 06/08/1999 9.1
(54) APERFEIÇOAMENTO INTRODUZIDO EM
LEIAUTE DE CARTÃO DE DÉBITO INDUTIVO
(71) Fundação CPqD- Centro de Pesquisa e
Desevolvimento em Telecomunicações. (BR/SP)
(74) Ana Lúcia Forni Poppi
(21) MU 8100450-8 U2 (22) 13/03/2001 9.1
(54) DISPOSIÇÃO CONSTRUTIVA EM CALÇO E
BASE PARA SANTANTONIO
(71) Keko Acessórios S/A. (BR/RS)
(74) SKO - Oyarzáball Marcas & Patentes S/S Ltda.
(21) MU 8100562-8 U2 (22) 16/03/2001 9.1
(54) APARELHO INFLADOR PARA BALÕES
(71) Carlos Reinaldo Mette (BR/SC)
(74) Fabiana Crema / Portobelo Assessoria
Empresarial
(21) MU 8102614-5 U2 (22) 15/10/2001 9.1
(54) UNIÃO REGISTRO PARA CONSERTOS DE
RAMAIS DE ÁGUA
(71) Firmino Mendes da Silva Filho (BR/SP) ,
Antonio de Oliveira Martins (BR/SP)
(21) MU 8202148-1 U2 (22) 04/09/2002 9.1
(54) DISPOSITIVO DE SEGURANÇA APLICADO
EM COLETE
(66) PI0105105-9 10/09/2001
(71) Luiz Alberto Cunha (BR/GO)
(74) Wagner José da Silva
(21) MU 8301175-7 U2 (22) 09/06/2003 9.1
(54) DISPOSIÇÃO INTRODUZIDA EM
PRESSURIZADOR PARA TROCA DE FLUIDO DE
FREIO DE AUTOMÓVEIS E ASSEMELHADOS
(71) Cláudio de Lima Vieira (BR/SP) , Wilson de
Lima Vieira (BR/SP)
(74) City Patentes e Marcas LTDA
(21) MU 8303306-8 U2 (22) 29/12/2003 9.1
(54) DISPOSIÇÃO CONSTRUTIVA EM SISTEMA
DE ARTICULAÇÃO MECÂNICA PARA ASSENTO
DE VASO SANITÁRIO
(71) Akitoshi Murata (BR/RS)
(74) Mario de Almeida Marcas e Patentes Ltda
(21) PI 0300724-3 A2 (22) 20/03/2003 9.1
(54) MOTOR
(71) Honda Giken Kogyo Kabushiki Kaisha (JP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0301480-0 A2 (22) 23/05/2003 9.1
(21) PI 0303722-3 A2 (22) 20/08/2003 9.1
(54) SISTEMA DE SOBREALIMENTAÇÃO PARA
MOTOR DE COMBUSTÃO INTERNA
(71) Borg Warner Inc. (US)
(74) Antonio Mauricio Pedras Arnaud
(21) PI 0304118-2 A2 (22) 29/08/2003 9.1
(54) APARELHO DE PÁRA-BRISA PARA
MOTOCICLETAS
(71) Honda Giken Kogyo Kabushiki Kaisha (JP)
(74) Dannemann, Siemen, Bigler & Ipanema Moreira
(21) PI 0304867-5 A2 (22) 15/05/2003 9.1
(54) DISPOSIÇÃO DE DUAS ARTICULAÇÕES
(71) ZF Lemfoerder Metallwaren AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0305109-9 A2 (22) 25/09/2003 9.1
(54) SISTEMA PARA MEDIR OU DISPENSAR
BIOCIDA SÓLIDO
(66) PI0204140-5 25/09/2002
(71) Du Pont do Brasil S.A. (BR/SP)
(74) Lucas Martins Gaiarsa
(21) PI 0305296-6 A2 (22) 13/11/2003 9.1
(54) SISTEMA DE ELEVAÇÃO E DESCARGA
DIRETA DE MATÉRIAS-PRIMAS EM SILOS
(71) Ligas de Alumínio S.A. - LIASA (BR/MG)
(74) Nellie Anne Daniel Shores
(21) PI 0305382-2 A2 (22) 10/11/2003 9.1
(54) EQUIPAMENTO PARA DESCONEXÃO
RÁPIDA DE CABO DE ELETRICIDADE E
MANGUEIRA DE AR COMPRIMIDO
(71) Luis Carlos Leite (BR/RS)
(74) Grupo Princesa Marca e Patentes LTDA
(21) PI 0305774-7 A2 (22) 09/07/2003 9.1
(54) EIXO LONGITUDINAL
(71) Shaft-Form-Engineering GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0306146-9 A2 (22) 22/08/2003 9.1
(54) CONJUNTO DE VÁLVULA PARA
COMPRESSOR ALTERNADO
(71) LG Electronics INC. (KR)
(74) Nellie Anne Daniel Shores
(21) PI 0308625-9 A2 (22) 24/03/2003 9.1
(54) INJETOR DE COMBUSTÍVEL PARA UM
MOTOR DE COMBUSTÃO INTERNA
(71) Philip Morris USA Inc. (US)
(74) Di Blasi, Parente, Soerensen Garcia &
Associados S/C Ltda.
(21) PI 0308671-2 A2 (22) 19/03/2003 9.1
(54) SISTEMA ANTI-DETONAÇÃO DE
DISTRIBUIÇÃO DE COMBUSTÍVEL
(71) Better Burn, LLC (US)
(74) Dmark Registros de Marcas e Patentes Ltda
(21) PI 0308715-8 A2 (22) 21/03/2003 9.1
(54) SISTEMA DE MONITORAMENTO PARA
POÇOS DE ELEVADORES
(71) Inventio Aktiengesellschaft (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0308797-2 A2 (22) 17/03/2003 9.1
(54) USINA ELÉTRICA PARA A PRODUÇÃO DE
FRIO
(71) Siemens Aktiemgesellschaft (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0309013-2 A2 (22) 08/04/2003 9.1
(54) MOTOR
(71) Yamaha Hatsudoki Kabushiki Kaisha (JP)
(74) Nellie Anne Daniel Shores
(21) PI 0309136-8 A2 (22) 04/04/2003 9.1
128
DIRPA - Despachos Relativos a Pedidos e Patentes
(54) ESTRUTURA DE NESGA EM Y
(71) ThyssenKrupp Steel AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0309192-9 A2 (22) 03/12/2003 9.1
(54) DISPOSITIVO DO LIMPADOR DE PÁRABRISA
(71) Robert Bosch GMBH (DE)
(74) Dannemann, Siemsen & Ipanema Moreira
(21) PI 0309295-0 A2 (22) 27/03/2003 9.1
(54) SISTEMA DE INJEÇÃO DE COMBUSTÍVEL
(71) Volvo Lastvagner AB (SE)
(74) Magnus Aspeby
(21) PI 0309381-6 A2 (22) 21/04/2003 9.1
(54) SISTEMA DE GERENCIAMENTO DE
PRESSÃO DE PNEU PARA VEÍCULO, MÉTODO
PARA CONTROLAR SISTEMA DE
GERENCIAMENTO DE PRESSÃO DE PNEU DE
VEÍCULO
(71) Dana Heavy Vehicle Systems Group, LLC (US)
(74) Bhering Advogados
(21) PI 0309453-7 A2 (22) 04/03/2003 9.1
(54) DISPOSITIVO E MÉTODO PARA
AGARRAMENTO DE PELO MENOS UM
ELEMENTO ALONGADO
(71) Volvo Construction Equipment Holding Sweden
AB (SE)
(74) Thomaz Thedim Lobo e Magnus Aspeby
(21) PI 0309834-6 A2 (22) 07/05/2003 9.1
(54) MÉTODO PARA REGENERAÇÃO DE UM
FILTRO DE PARTÍCULAS E UM VEÍCULO EM
QUE TAL MÉTODO É UTILIZADO
(71) Volvo Lastvagnar AB (SE)
(74) Thomaz Thedim Lobo
(21) PI 0310109-6 A2 (22) 07/07/2003 9.1
(54) BRAÇO DE SUSPENSÃO PARA UM VEÍCULO
MOTORIZADO
(71) ZF Ansa Lemförder, S.L. (ES)
(74) Martinez & Moura Barreto S/C Ltda
(21) PI 0310124-0 A2 (22) 17/12/2003 9.1
(54) LÂMINA DE ROTOR DE UMA INSTALAÇÃO
DE ENERGIA EÓLICA, PROCESSO E
DISPOSITIVO PARA MEDIR A FLEXÃO OU
ALTERAÇÃO NO COMPRIMENTO DE UM
PRODUTO, E, INSTALAÇÃO DE ENERGIA
EÓLICA
(71) Aloys Wobben (DE)
(74) Momsen, Leonardos & Cia.
(21) PI 0311240-3 A2 (22) 20/05/2003 9.1
(54) PISTÃO PARA MOTORES DE COMBUSTÃO
(71) Mahle GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0311634-4 A2 (22) 30/04/2003 9.1
(54) SUSPENSÃO DE RODA DIANTEIRA
INDEPENDENTE, VEÍCULO EQUIPADO COM
UMA TAL SUSPENSÃO DE RODA DIANTEIRA, E
MÉTODO DE PRODUÇÃO DE UMA SUSPENSÃO
EM MOLA
(71) Volvo Lastvagnar AB (SE)
(74) Thomaz Thedim Lobo
(21) PI 0311847-9 A2 (22) 12/06/2003 9.1
(54) SISTEMA DE ANCORAGEM PARA MANTER
UM NAVIO ANCORADO DURANTE
CARREGAMENTO OU DESCARREGAMENTO
(71) Advanced Production And Loading AS (NO)
(74) Momsen, Leonardos & Cia.
(21) PI 0313074-6 A2 (22) 08/07/2003 9.1
(54) EMARANHADO PARA MONTAGEM DE UM
ELEMENTO DE CONTROLE DE POLUIÇÃO EM
UM INVÓLUCRO DE UM DISPOSITIVO DE
CONTROLE DE POLUIÇÃO, DISPOSITIVO DE
CONTROLE DE POLUIÇÃO, MÁQUINA E
MÉTODO DE TRATAR GÁS DE ESCAPAMENTO
DE UM MOTOR A DIESEL.
(71) 3M Innovative Properties Company (US)
(74) Momsen, Leonardos & Cia.
(21) PI 0317664-9 A2 (22) 12/12/2003 9.1
(54) MÉTODO E INSTALAÇÃO PARA O
TRATAMENTO TÉRMICO DE SÓLIDOS
CONTENDO ÓXIDO DE FERRO
(71) Outokumpu Technology Oy (FI)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0405174-2 A2 (22) 26/11/2004 9.1
(54) SISTEMA ARTICULADOR PARA BARRAS DE
PULVERIZAÇÃO
(71) Ailto Tomio Mizota (BR/PR)
(74) Ivando Santos Souza
(21) PI 0407363-0 A2 (22) 03/02/2004 9.1
(54) MÉTODO E APARELHO PARA PRODUÇÃO
DE UMA LIGA DE METAL SEMI-SÓLIDA
(71) Csir (ZA)
(74) Momsen, Leonardos & Cia
(21) PI 0407984-1 A2 (22) 03/03/2004 9.1
(54) ATUADOR PARA ATUAR UMA VÁLVULA DE
AEROSSOL PARA DISTRIBUIR UM PRODUTO
AEROSSOL A PARTIR DE UM RECIPIENTE DE
AEROSSOL
(71) Seaquist Perfect Dispensing Foreign, INC. (US)
(74) Momsen, Leonardos & Cia
(21) PI 0410718-7 A2 (22) 28/05/2004 9.1
(54) MÁQUINA DE LAVAR ROUPAS E MÉTODO
DE CONTROLE DA MESMA
(71) LG Electronics INC (KR)
(74) Nellie Anne Daniel -Shores
(21) PI 9915950-3 A2 (22) 02/12/1999 9.1
(54) BENZOILPIRAZOL SUBSTITUÍDO POR 3HETEROCICLILA, PROCESSO PARA PREPARAR
BENZOILPIRAZÓIS SUBSTITUÍDOS POR 3HETEROCICLILA, ÉSTER DE ÁCIDO BENZÓICO,
DERIVADO DE 3-(HETEROCICLILA) BENZENO,
COMPOSIÇÃO, PROCESSOS PARA PREPARAR
COMPOSIÇÕES E PARA CONTROLAR
VEGETAÇÃO INDESEJÁVEL, USO DOS
BENZOILPIRAZÓIS SUBSTITUÍDOS POR 3HETEROCICLILA
(71) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & CIA.
(21) PI 9917732-3 A2 (22) 12/04/1999 9.1
(54) "MÉTODO E EQUIPAMENTO PARA
DETERMINAR UM TEMPO DE REFERÊNCIA."
(62) PI9909673-0 12/04/1999
(71) Qualcomm Incorporated (US)
(74) Montaury Pimenta, Machado & Lioce
(21) PI 9917733-1 A2 (22) 12/04/1999 9.1
(54) "MÉTODO E EQUIPAMENTO PARA
DETERMINAR UM TEMPO ASSOCIADO A UM
SISTEMA DE POSICIONAMENTO POR SATÉLITE"
(62) PI9909673-0 12/04/1999
(71) Qualcomm Incorporated (US)
(74) Montaury Pimenta, Machado & Lioce
(21) PI 0002650-6 A2 (22) 07/07/2000 9.1
(54) PROCESSO PARA A RACEMIZAÇÃO DE
COMPOSTOS ATROPISOMÉRICOS,SEU USO E
PROCESSO PARA A FABRICAÇÃO DE
COMPLEXOS DE METAL DE TRANSIÇÃO
OPTICAMENTE ATIVOS
(71) F. Hoffmann-La Roche AG (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0004550-0 A2 (22) 29/09/2000 9.1
(54) PROCESSO DE PRODUÇÃO DE GASOLINAS
COM ÍNDICE DE OCTANO MELHORADO
(71) Institut Francais Du Petrole (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0009872-8 A2 (22) 12/04/2000 9.1
(54) INDICADOR DE UMIDADE, USO DE UM
COMPOSTO, PROCESSOS DE MONITORAÇÃO
DO NÍVEL DE UMIDADE NUMA ATMOSFERA, E
DE PRODUÇÃO DE UM INDICADOR DE UMIDADE
(71) Ineos Silicas Limited (GB)
(74) Momsen, Leonardos & CIA.
(21) PI 0013500-3 A2 (22) 09/08/2000 9.1
(54) PROCESSO PARA A REMOÇÃO DE
COMPOSTOS ORGANOSSULFURADOS DE UMA
CORRENTE DE GASOLINA CRAQUEADA OU DE
ÓLEO DE DIESEL
RPI 2109 de 07/06/2011
(71) China Petroleum & Chemical Corporation (CN)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0100554-5 A2 (22) 15/02/2001 9.1
(54) DISPOSITIVO DE ACONDICIONAMENTO E
DE APLICAÇÃO QUE POSSUI UMA ESTRUTURA
POROSA QUE INCORPORA UM AGENTE
BIOCIDA
(71) L'Oreal (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0101207-0 A2 (22) 28/03/2001 9.1
(54) PROCESSO DE PRODUÇÃO DE GASOLINA
COM BAIXO TEOR DE ENXOFRE, A PARTIR DE
UMA CARGA CONTENDO ENXOFRE
(71) Institut Francais du Petrole (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0101208-8 A2 (22) 28/03/2001 9.1
(54) CATALISADOR DE CAMADA ÚNICA DE ALTO
DESEMPENHO
(71) Umicore AG & Co. KG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0110721-6 A2 (22) 09/05/2001 9.1
(54) PROCESSO PARA TRATAR UMA FRAÇÃO
C4, E, DISPOSITIVO PARA REALIZAR O MESMO
(71) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & Cia.
(21) PI 0110858-1 A2 (22) 16/05/2001 9.1
(54) MÉTODOS PARA FAZER PEÇAS DE ROUPA
COM COMPONENTES DE FIXAÇÃO
(71) Kimberly-Clark Worldwide, INC. (US)
(74) Pinheiro Neto Advogados
(21) PI 0110941-3 A2 (22) 02/05/2001 9.1
(54) PACOTE DE EMBALAGEM PARA CIGARROS
(71) Focke & CO. (GMBH & CO.) (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0111071-3 A2 (22) 21/05/2001 9.1
(54) RECIPIENTE MOLDADO A SOPRO, QUE
PODE SER ENCHIDO A QUENTE
(71) Amcor Pet Packaging USA, INC. (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0111435-2 A2 (22) 01/06/2001 9.1
(54) " SISTEMA DE PEÇAS PLANAS "
(71) M. Kaindl (AT)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0113196-6 A2 (22) 03/08/2001 9.1
(54) FOLHA DE TOPO PARA CONTACTO COM O
TECIDO DO CORPO PARA UM ARTIGO
ABSORVENTE, DISPOSITIVO E ARTIGO
ABSORVENTE INSERÍVEL NO ESPAÇO
INTERLABIAL DE UMA USUÁRIA FEMININA,
TAMPÃO QUE COMPREENDE A FOLHA DE
TOPO E PROCESSO PARA CAPTURAR
DESCARGAS PROVENIENTES DE UMA FONTE
DE DESCARGAS NO CORPO DE UMA USUÁRIA
(71) The Procter & Gamble Company (US)
(74) Trench, Rossi e Watanabe
(21) PI 0114055-8 A2 (22) 13/09/2001 9.1
(54) DISPOSITIVO DE FECHAMENTO TIPO
PERSIANA
(71) Dynaco International (BE)
(74) Paulo C.Oliveira & Cia
(21) PI 0114254-2 A2 (22) 27/09/2001 9.1
(54) " DISTRACTOR MAXILAR PARA
MODIFICAÇÃO DA DISTÂNCIA ENTRE O
MAXILAR E O ZIGOMA "
(71) Synthes GmbH (CH)
(74) Tavares Propriedade Intelectual Ltda.
(21) PI 0115588-1 A2 (22) 12/11/2001 9.1
(54) CONDUTO TUBULAR FLEXÍVEL
(71) Institut Français du Petrole (FR) , Technip
France (FR)
(74) Momsen, Leonardos & Cia.
(21) PI 0115740-0 A2 (22) 27/07/2001 9.1
RPI 2109 de 07/06/2011
DIRPA - Despachos Relativos a Pedidos e Patentes 129
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o art. 8º combinado
com o art. 13 da LPI.
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 24 da
LPI.
(21) PI 9910465-2 A2 (22) 12/05/1999 9.2
(54) USO DE UM AGENTE QUE MANTÉM OU
MELHORA A BARREIRA DE PERMEABILIDADE
DA GENGIVA
(71) Unilever N.V (NL)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
24 e 25 da LPI.
(21) PI 0116848-7 A2 (22) 11/12/2001 9.1
(54) " MÉTODO DE FABRICAÇÃO DE
DISPOSITIVO DE ILUMINAÇÃO PARA
SIMULAÇÃO DE LUZ NEON "
(71) Ilight Technologies, INC. (US)
(74) Nellie Anne Daniel Shores
(21) PI 9613016-4 A2 (22) 30/08/1996 9.2
(54) COMPOSIÇÃO SINTERIZADA ARTIFICIAL
BIOATIVA PARA SUPORTAR
CONSISTENTEMENTE A ATIVIDADE DE CÉLULA
DE OSSO, ESTRUTURA MICROPOROSA
CERÂMICA APARENTE, DISPOSITIVO
IMPLANTÁVEL, PROCESSO PARA O CULTIVO
DE CÉLULAS DE OSSOS FUNCIONAIS E KIT
PARA MONITORAR E QUANTIFICAR AS
ATIVIDADES DE TAIS CÉLULAS
(62) PI9610357-4 30/08/1996
(71) Millenium Biologix Technologies, Inc. (CA)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º c/c
13 da LPI.
(21) PI 0200002-4 A2 (22) 03/01/2002 9.1
(54) COMPOSTOS PARA PAREDE LATERAL DE
PNEUMÁTICOS POSSUINDO RESISTÊNCIA À
FADIGA POR FLEXÃO E COMPOSTO PARA
BANDA DE RODAGEM POSSUINDO
RESISTÊNCIA AO RASGAMENTO
(71) The Goodyear Tire & Rubber Company (US)
(74) Matilde da Rocha Reis Castellani
(21) PI 9705603-0 A2 (22) 29/12/1997 9.2
(54) PROCESSO E APARELHO DE
CODIFICAÇÃO/DECODIFICAÇÃO DE DADOS
DIGITAIS
(71) Samsung Eletronics Co., Ltd (KR)
(74) Paulo C. Oliveira & Cia.
Indefiro o pedido de acordo com o art. 8º combinado
com o art. 13 da LPI.
(21) PI 0204030-1 A2 (22) 30/09/2002 9.1
(54) PROCESSO PARA OTIMIZAR A REMOÇÃO
DE REBOCOS FORMADOS NAS PAREDES DE
POÇOS HORIZONTAIS POR FLUIDOS DE
PERFURAÇÃO DRILL-IN
(71) Petroleo Brasileiro S.A. - PETROBRAS
(BR/RJ)
(74) Antonio Claudio Correa Meyer Sant'Anna
(21) PI 9902767-4 A2 (22) 17/06/1999 9.2
(54) SISTEMA SENSOR DE DESVIO DE CAMPO
(71) Dimona Sistemas de Automação Ltda. (BR/SP)
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 9912735-0 A2 (22) 06/08/1999 9.2
(54) CIRCUITO DE CONTROLE AUTOMÁTICO DE
GANHO PARA CONTROLAR MÚLTIPLOS
ESTÁGIOS DE AMPLIFICADOR DE GANHO
VARIÁVEL ENQUANTO ESTIMA A POTÊNCIA DO
SINAL RECEBIDO
(71) Qualcomm Incorporated (US)
(74) Montaury Pimenta, Machado & Lioce
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 9903081-0 A2 (22) 30/06/1999 9.2
(54) COMPOSIÇÃO E PROCESSO PARA
TINTURAR DAS FIBRAS QUERATÍNICAS E
DISPOSITIVO DE TINTURA COM MULICOMPORTAMENTO
(71) L'oreal (FR)
(74) Francisco Carlos Rodrigues Silva
Indefiro o pedido de acordo com o(s) artigo(s) 8º c/c
13 da LPI.
(21) PI 9913589-2 A2 (22) 05/05/1999 9.2
(54) COMPOSIÇÃO, E, PROCESSO COSMÉTICO
PARA REDUZIR ARDÊNCIA OU IRRITAÇÃO
INDUZIDAS PELA APLICAÇÃO TÓPICA DE UMA
COMPOSIÇÃO
(71) Unilever N.V. (NL)
(74) Paola Calabria Mattioli
Indefiro o pedido de acordo com o(s) artigo(s) 8º c/c
13 da LPI.
(21) PI 9903257-0 A2 (22) 30/07/1999 9.2
(54) CONCENTRADO DE SUSPENSÃO AQUOSA
CONTENDO TIADIAZURONA E ETEFONA
(71) Bayer CropScience AG (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
13 e 25 da LPI.
(21) PI 9913640-6 A2 (22) 10/08/1999 9.2
(54) AGENTE HERBICIDA PARA CULTURAS DE
SOJA TOLERANTES OU RESISTENTES
(71) Bayer CropScience AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º c/c
13 da LPI.
(21) PI 9906091-4 A2 (22) 22/12/1999 9.2
(54) USOS DE RESINA DE TROCA ANIÔNICA
(EPM-7) COMO SUPORTE SÓLIDO PARA A
SÍNTESE PEPTÍDICA E PARA CROMATOGRAFIA
DE AFINIDADE
(71) Conselho Nacional de Desenvolvimento
Científico e Tecnológico-CNPq (BR/DF)
(74) Eury Pereira Luna Filho
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 9913641-4 A2 (22) 10/08/1999 9.2
(54) AGENTES HERBICIDAS COM
AMINOFENILSULFONILURÉIAS ACILADAS
(71) Bayer CropScience AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º c/c
13 da LPI.
(54) MÉTODO PARA APLICAR UM DISPOSITIVO
DE ABERTURA A UM MATERIAL DE
EMBALAGEM EM FOLHA PARA EMBALAR
PRODUTOS ALIMENTÍCIOS DERRAMÁVEIS, E,
EMBALAGEM VEDADA PARA PRODUTOS
ALIMENTÍCIOS DERRAMÁVEIS
(71) Tetra Laval Holdings & Finance SA (CH)
(74) Momsen, Leonardos & Cia.
(21) PI 0115822-8 A2 (22) 07/11/2001 9.1
(54) PROTETOR DE ROUPA ÍNTIMA DE DUPLO
USO
(71) Kimberly-Clark Worldwide , INC (US)
(74) Pinheiro Neto Advogados
(21) PI 0206661-0 A2 (22) 08/01/2002 9.1
(54) PROCESSO DE PRODUÇÃO DO BISFENOL A
(71) Atofina (FR)
(74) Clarke Modet do Brasil Ltda
(21) PI 0208434-1 A2 (22) 28/03/2002 9.1
(54) MÉTODO PARA IMPEDIMENTO DE
FORMAÇÃO DE PRESSÃO ANULAR CRÍTICA
(71) Hunting Energy Services, Inc. (US)
(74) Tavares Propriedade Intelectual Ltda.
(21) PI 0215658-0 A2 (22) 30/09/2002 9.1
(54) DISPOSITIVO PARA CONTENÇÃO E
SUPRIMENTO DE MATERIAL A GRANEL
(71) System S.p.A. (IT)
(74) Tavares Propriedade Intelectual LTDA
9.1.1
DECISÃO ANULADA(**)
(21) PI 0210193-9 A2 (22) 25/04/2002 9.1.1
(54) PELÍCULA FORMADA A VÁCUO E ARTIGO
ABSORVENTE
(71) Tredegar Film Products Corporation (US)
(74) Advocacia Pietro Ariboni S/C
Referente a RPI 2085, de 21/12/2010, item de
despacho 9.1. Anulação da decisão de deferimento,
face o pagamento de taxa indevido.
9.2
INDEFERIMENTO
(21) MU 8000177-7 U2 (22) 27/01/2000 9.2
(54) SISTEMA TEMPORIZADOR PARA
CONJUNTO DE SINALIZAÇÃO VISUAL PARA
PASSAGEM OU PREFERÊNCIA
(71) Meng Engenharia Comércio e Indústria LTDA
(BR/SP)
(74) Nobel Marcas e Patentes S/C Ltda.
Indefiro o pedido de acordo com o artigo 9º da LPI
(21) PI 0402169-0 A2 (22) 25/05/2004 9.2
(54) SILO PARA RESFRIAMENTO ARTIFICIAL
DINÂMICO DE GRÃOS E SEMENTES
(71) Francisco Maria Ayala Barreto (BR/PR)
(74) Eduardo Pereira da Silva
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI
(21) PI 9611701-0 A2 (22) 08/10/1996 9.2
(54) RECEPTOR DE GPS E MÉTODO PARA
PROCESSAMENTO DE SINAIS DE GPS.
(71) Snaptrack, Inc. (US)
(21) PI 9906740-4 A2 (22) 16/08/1999 9.2
(54) COMPOSIÇÃO CAPILAR, DISPOSITIVO
AEROSSOL, PROCESSO PARA MODELAGEM OU
CONSERVAÇÃO DO PENTEADO E UTLIZAÇÃO
DE UMA COMPOSIÇÃO
(71) L'oreal (FR)
(74) Francisco Carlos Rodrigues Silva
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 9908654-9 A2 (22) 07/12/1999 9.2
(54) CARREGAMENTO E BAIXAMENTO DE
INFORMAÇÃO AUDITRON A UM PC OU A UMA
LINHA TELEFÔNICA
(71) Xerox Corporation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 9909659-5 A2 (22) 18/03/1999 9.2
(54) MODULADORES DA FUNÇÃO DE
RECEPTORES DA FAMÍLIA DOS RECEPTORES
PARA TNF/NGF E OUTRAS PROTEÍNAS
(71) Yeda Research and Development Co. Ltd (IL) ,
Albert Einstein College of Medicine of Yeshiva
University (US)
(21) PI 9910955-7 A2 (22) 25/06/1999 9.2
(54) MÉTODO E SISTEMA DE COMPUTADOR DE
ACESSAMENTO, VISÃO E MANIPULAÇÃO DE
DADOS ARMAZENADOS EM SISTEMA DE
COMPUTADOR E DISPOSITIVO DE
ARMAZENAGEM CAPAZ DE SER LIDO POR
COMPUTADOR
(71) Copernican Technologies, Inc. (US)
(74) Hugo Casinhas da Silva
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 e artigo 10 da LPI
(21) PI 9915827-2 A2 (22) 22/10/1999 9.2
(54) MÉTODO E APARELHO PARA RESTAURAR
UM CANAL DE DISPOSITIVO DE MEMÓRIA
QUANDO SAINDO DE UM ESTADO DE BAIXA
ENERGIA
(71) Intel Corporation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 9916998-3 A2 (22) 29/12/1999 9.2
(54) EXAMINADOR COMPACTO DE CÓDIGOS DE
BARRAS
(71) Symbol Technologies, Inc. (US)
(74) Antonio Maurício Pedras Arnaud
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 9917632-7 A2 (22) 15/07/1999 9.2
(54) ESTRUTURA DE DADOS PARA
GERENCIAMENTO DE DEFEITOS NA
INFORMAÇÃO GRAVADA EM UM MEIO DE
GRAVAÇÃO ÓTICA.
(62) PI9906653-0 15/07/1999
(71) LG Electronics Inc. (KR)
(74) BHERING ADVOGADOS
Indefiro o pedido de acordo com o artigo 6º da LPI
(21) PI 0000571-1 A2 (22) 12/01/2000 9.2
130
DIRPA - Despachos Relativos a Pedidos e Patentes
(54) UTILIZAÇÃO DE COMPOSTOS,
COMPOSIÇÃO DE TINTURA PARA MATÉRIAS
QUERATÍNICAS, COMPOSIÇÃO DE TINTURA,
DIRETA PARA FIBRAS QUERATÍNICAS
HUMANAS E PROCESSO DE TINTURA DAS
FIBRAS QUERATÍNICAS
(71) L'oreal (FR)
(74) Jacques Labrunie
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13,
15 e 25 da LPI.
(21) PI 0001326-9 A2 (22) 15/03/2000 9.2
(54) PLASMÍDEO, REGIÃO DE CONTROLE DE
REPLICAÇÃO SENSÍVEL A TEMPERATURA, E,
PROCESSO PARA CRIAR UMA BACTÉRIA
CORINEFORME
(71) Ajinomoto CO., INC. (JP)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0001615-2 A2 (22) 14/04/2000 9.2
(54) SISTEMA DE GERENCIAMENTO DE FUNÇÃO
EM UM VEÍCULO
(71) Deere & Company (US)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 0006122-0 A2 (22) 11/04/2000 9.2
(54) TINTURAS OXIDATIVAS PARA OS CABELOS
(71) Wella Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11
e 25 da LPI.
(21) PI 0008968-0 A2 (22) 24/02/2000 9.2
(54) SUPERFÍCIES HEMOCOMPATÍVEIS E
PROCESSO PARA A PRODUÇÃO DAS MESMAS
(71) Michael Hoffmann (DE) , Roland Horres (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(VIII), 13, 24 e 25 da LPI.
(21) PI 0009300-9 A2 (22) 24/03/2000 9.2
(54) PRODUTO ALIMENTAR NÃO FERMENTADO,
E, PROCESSO PARA CONSERVAÇÃO DE UM
PRODUTO ALIMENTAR NÃO FERMENTADO
(71) General Mills Marketing, Inc. (US)
(74) Momsen, Leonardos & Cia.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0009485-4 A2 (22) 30/03/2000 9.2
(54) MÉTODO E COMPOSIÇÕES PARA EVITAR
OU REDUZIR INFECÇÃO POR HIV PELO USO DE
INIBIDORES PARA LEUCINA AMINOPEPTIDASE
(71) Canbreal Therodiagnostics Canadian Holding
Corporation (CA) , Her Majesty The Queen In Right
Of Canada As Represented By The Minister Of
Health (CA)
(74) Belleza Marcas e Patentes Ltda.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(VIII), 13 e 24 da LPI.
(21) PI 0009847-7 A2 (22) 19/04/2000 9.2
(54) KIT DE PARTES, MÉTODO DE PREPARAÇÃO
DE UM KIT DE PARTES, FORMULAÇÃO
FARMACÊUTICA, MÉTODO DE TRATAMENTO DE
UMA CONDIÇÃO NA QUAL INIBIÇÃO DE
TROMBINA É REQUERIDA OU DESEJADA, E,
USO DE UM INIBIDOR DE TROMBINA, OU DE UM
DERIVADO FARMACEUTICAMENTE ACEITÁVEL
DO MESMO
(71) Astrazeneca AB (SE)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13,
24 e 25 da LPI.
(21) PI 0010062-5 A2 (22) 27/04/2000 9.2
(54) PROCESSO DE PURIFICAÇÃO DE
FITOESTERÓIS A PARTIR DE FONTES
DERIVADAS DE PLANTA OU MADEIRA E
COMPOSIÇÕES RESULTANTES DESTE
(71) Forbes Medi-Tech INC. (CA)
(74) Alexandre Ferreira
Indefiro o pedido de acordo com o(s) artigo(s) 10
(VIII e IX), 11, 13 e 25 da LPI.
(21) PI 0010444-2 A2 (22) 08/05/2000 9.2
(54) DISPOSITIVO PARA TRATAMENTO DE
FERIMENTO E PROCESSO PARA TRATAR UM
FERIMENTO
(71) D & E Cryo CC (ZA)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(VIII), 13 e 25 da LPI.
(21) PI 0011137-6 A2 (22) 20/04/2000 9.2
(54) IMPLANTE PARA A RECONSTITUIÇÃO DE
VÉRTEBRAS E OSSOS TUBULARES
(71) K.H. Schmidt (DE)
(74) Tinoco Soares & Filho S/C Ltda.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
13 e 25 da LPI.
(21) PI 0011142-2 A2 (22) 20/04/2000 9.2
(54) UTILIZAÇÃO DE UM COMPLEXO DE
PRINCÍPIOS ATIVOS PARA A CONFECÇÃO DE
PARTES BIOLÓGICAS E ENDOPRÓTESE
REVESTIDA COM COMPLEXO DE PRINCÍPIOS
ATIVOS
(71) K.H. Schmidt (DE)
(74) Tinoco Soares & Filho S/C Ltda.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
13 e 25 da LPI.
(21) PI 0011876-1 A2 (22) 23/06/2000 9.2
(54) ADESIVO DE POSICIONAMENTO SENSÍVEL
À PRESSÃO TERMO-REVERSÍVEL, E, ARTIGO
ABSORVENTE
(71) Kraton Polymers Research B.V. (NL)
(74) Momsen, Leonardos & CIA.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0011877-0 A2 (22) 23/06/2000 9.2
(54) ADESIVO DE POSICIONAMENTO SENSÍVEL
À PRESSÃO TERMORREVERSÍVEL PARA USO
EM UM ARTIGO ABSORVENTE
(71) Kraton Polymers Research B.V. (NL)
(74) Momsen, Leonardos & Cia.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0012071-5 A2 (22) 28/06/2000 9.2
(54) DISTRIBUIDOR VOLÁTIL ACIONADO A
BATERIA
(71) S.C. Johnson & Son, INC. (US)
(74) Daniel & Cia
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0012424-9 A2 (22) 13/07/2000 9.2
(54) PEPTÍDEOS MENINGOCÓCICOS
ANTIGÊNICOS
(71) Chiron S.P.A. (IT)
(74) Clarke Modet do Brasil Ltda.
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
10 (IX), 24 e 25 da LPI.
(21) PI 0012572-5 A2 (22) 17/06/2000 9.2
(54) PROCESSO PARA PRODUÇÃO DE LAMINOÁCIDOS DE SEUS DERIVADOS
RACÊMICOS DE N-ACETIL-D, L POR
DISSOCIAÇÃO DE RACEMATO ENZIMÁTICA POR
MEIO DE ENZIMAS ISOLADAS,
RECOMBINANTES
(71) Bayer CropScience AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(IX) e 25 da LPI.
(21) PI 0013228-4 A2 (22) 11/08/2000 9.2
(54) MÉTODO E COMPOSIÇÕES UTILIZADOS
PARA MODULAÇÃO DE ANGIOGENESE USANDO
PROTEÍNA QUINASE RAF E RAS
(71) The Scripps Research Institute (US)
(74) Clarke Modet do Brasil Ltda
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(VIII), 13 e 25 da LPI.
(21) PI 0013996-3 A2 (22) 05/08/2000 9.2
(54) PLANTA TRANSFORMADA E SEUS
DESCENDENTES, GENE TRANSLOCADOR DE
ATP/ADP, ESTRUTURA GÊNICA, VETOR,
SEMENTES, TECIDOS OU CÉLULAS OU
MATERIAL, PROCESSO PARA PREPARAR UMA
PLANTA E UTILIZAÇÃO DE PLANTAS
TRASFORMADAS
(71) Basf Plant Science GMBH (DE)
RPI 2109 de 07/06/2011
(74) Momsen, Leonardos & Cia.
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0014486-0 A2 (22) 03/10/2000 9.2
(54) COMPOSIÇÕES FARMACÊUTICAS
CONTENDO POLIPEPTÍDEO LÍQUIDO
ESTABILIZADO
(71) Novartis Vaccines & Diagnostics, Inc. (US)
(74) Orlando de Souza
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 11,
13, 24 e 25 da LPI.
(21) PI 0015736-8 A2 (22) 29/11/2000 9.2
(54) DERIVADOS DE ADENOSINA MODIFICADOS
POR N6 HETEROCÍCLICO 8
(71) CV Therapeutics, INC. (US)
(74) Clarke Modet do Brasil Ltda
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0016126-8 A2 (22) 01/12/2000 9.2
(54) AGONISTAS TOTAIS OU PARCIAIS DE A1
DERIVADOS N6 HETEROCÍCLICOS 5'-TIO
SUBSTITUÍDOS DE ADENOSINA
(71) CV Therapeutics, INC. (US)
(74) Clarke Modet do Brasil Ltda
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 10
(VIII), 11 e 25 da LPI.
(21) PI 0016621-9 A2 (22) 21/12/2000 9.2
(54) DETECÇÃO DE ÁCIDOS NUCLÉICOS
(71) Johnson & Johnson (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º, 13
e 25 da LPI.
(21) PI 0100909-5 A2 (22) 06/03/2001 9.2
(54) PROCESSO DE APROVEITAMENTO DO
ESTIPE DA PUPUNHA PARA CONFECÇÃO DE
MOBILIÁRIO
(71) Instituto Nacional de Pesquisas da Amazônia INPA (BR/AM)
(74) Atem & Remer Assessoria e Consultoria de
Propriedade Intelectual Ltda
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI
(21) PI 0104364-1 A2 (22) 01/10/2001 9.2
(54) PRODUTO E PROCESSO QUÍMICO
(71) Akzo Nobel N.V. (NL)
(74) Thomaz Thedim Lobo
Indefiro o pedido de acordo com o(s) artigo(s)
LPI
da
(21) PI 0106430-4 A2 (22) 25/04/2001 9.2
(54) SISTEMA E MÉTODO DE RESTRIÇÃO DE
ZONA DE ABLAÇÃO DE LASER
(71) Alcon Universal Ltd. (CH) , John Aldred Campin
(US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 da LPI
(21) PI 0111767-0 A2 (22) 13/06/2001 9.2
(54) COMPOSIÇÕES ANALGÉSICAS E ANTIINFLAMATÓRIAS CONTENDO INIBIDORES DE
COX-2, SEU USO E MÉTODO PARA
POTENCIALIZAR UM COMPOSTO ANALGÉSICO
(71) Wyeth (US)
(74) Antonio Mauricio Pedras Arnaud
Indefiro o pedido de acordo com o(s) artigo(s) da
LPI Indefiro o pedido de acordo com o(s) artigo(s)
(21) PI 0111939-7 A2 (22) 26/06/2001 9.2
(54) PROCESSO DE FABRICAÇÃO DE OXIRANO
(71) Solvay (BE)
(74) Momsen, Leonardos & Cia
Indefiro o pedido de acordo com o(s) artigo(s) da
LPI
(21) PI 0112007-7 A2 (22) 26/06/2001 9.2
(54) ESCOVA DE DENTES ELETRICAMENTE
ACIONADA
(71) Colgate-Palmolive Company (US)
(74) Momsen, Leonardos & Cia
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0112821-3 A2 (22) 27/07/2001 9.2
RPI 2109 de 07/06/2011
(54) FORMULAÇÃO APERFEIÇOADA DE ADITIVO
PARA COMBUSTÍVEL E PROCESSO DE USO
(71) Magnum Environmental Technologies, INC.
(US)
(74) Nellie Anne Daniel Shores
(21) PI 0113651-8 A2 (22) 29/08/2001 9.2
(54) MÉTODO PARA TRATAR DISFUNÇÃO
ERÉTIL E AUMENTAR A LIBIDO EM HOMENS
(71) Laboratoires Besins International, SAS (FR) ,
Unimed Pharmaceuticals, LLC (US)
(74) Nellie Anne Daniel Shores
Indefiro o pedido de acordo com o(s) artigo(s) da
LPI
(21) PI 0113825-1 A2 (22) 06/09/2001 9.2
(54) SISTEMA DE MICROCIRURGIA, MÉTODO
PARA MAPEAR FUNÇÕES CIRÚRGICAS DE UM
SISTEMA DE MICROCIRURGIA
(71) Alcon, INC. (CH)
(74) Momsen, Leonardos & Cia
Indefiro o pedido de acordo com o artigo 8º
combinado com artigo 13 e artigo 10 da LPI
(21) PI 0115431-1 A2 (22) 15/11/2001 9.2
(54) PROCESSO PARA A OBTENÇÃO, POR MEIO
DE DESTILAÇÃO, DE 1,3-BUTADIENO PURO A
PARTIR DE 1,3-BUTADIENO BRUTO, E, COLUNA
DE PAREDE DIVISÓRIA
(71) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & Cia
(21) PI 0115516-4 A2 (22) 19/11/2001 9.2
(54) COMPOSIÇÃO FARMACÊUTICA, E, MÉTODO
PARA PREVENIR OU TRATAR HIPERTENSÃO
(71) Daiichi Sankyo Company, Limited (JP)
(74) Momsen, Leonardos & Cia.
(21) PI 0116531-3 A2 (22) 20/12/2001 9.2
(54) COMPOSIÇÃO FARMACÊUTICA, KIT E USO
DE UM COMPOSTO
(71) Ube Industries, LTD. (JP) , Daiichi Sankyo
Company, Limited (JP)
(74) Momsen, Leonardos & Cia.
Indefiro o pedido de acordo com o(s) artigo(s) da
LPI
(21) PI 0205304-7 A2 (22) 16/12/2002 9.2
(54) MÉTODO PARA FABRICAR ELEMENTOS DE
CONSTRUÇÃO TAIS COMO LADRILHOS E LAJES
CERÂMICAS, PLANTA PARA IMPLEMENTAR O
MÉTODO, E, MATERIAIS DE CONSTRUÇÃO
CERÂMICA TAIS COMO LADRILHOS E LAJES
(71) Sacmi Cooperativa Meccanici Imola, Soc.
Coop. A.R.L. (IT)
(74) Momsen, Leonardos & Cia.
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0205311-0 A2 (22) 16/12/2002 9.2
(54) PROCESSO E PLANTA PARA CONFORMAR
LADRILHOS OU LAJES CERÂMICAS
(71) Sacmi Cooperativa Meccanici Imola, Soc.
Coop. A.R.L. (IT)
(74) Momsen, Leonardos & Cia
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0208296-9 A2 (22) 08/03/2002 9.2
(54) SISTEMA E MÉTODO PARA SUPERVISÃO
(71) Volvo Lastvagnar AB (SE)
(74) Thomaz Thedim Lobo e Magnus Aspeby
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0208620-4 A2 (22) 03/04/2002 9.2
(54) PRANCHÃO DE PAREDE EXTERNA DE
DUAS PEÇAS, PROCESSOS DE FABRICAÇÃO E
INSTALAÇÃO DO MESMO
(71) James Hardie International Finance B.V. (NL)
(74) Nellie Anne Daniel Shores
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0208621-2 A2 (22) 03/04/2002 9.2
(54) PRANCHÕES DE PAREDE EXTERNA DE
FIBROCIMENTO, PROCESSOS PRODUTIVOS
DELES E INSTALAÇÃO DOS MESMOS
(71) James Hardie International Finance B.V. (NL)
(74) Nellie Anne Daniel Shores
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0210591-8 A2 (22) 16/07/2002 9.2
DIRPA - Despachos Relativos a Pedidos e Patentes 131
(54) COBERTURA TIPO DE VENEZIANA PAPA
ABERTURAS ARQUITETÔNICAS
(71) Hunter Douglas Inc. (US)
(74) Clarke Modet do Brasil Ltda.
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
(21) PI 0212608-7 A2 (22) 08/03/2002 9.2
(54) MONTAGEM E MÉTODO DE FURO DE
FUNDO DE SUBESCAREAMENTO DIRIGÍVEL
(71) Halliburton Energy Services, INC. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Indefiro o pedido de acordo com o(s) artigo(s) 8º e
13 da LPI.
9.2.1
DECISÃO ANULADA (**)
(21) PI 9715364-8 A2 (22) 29/07/1997 9.2.1
(54) DISPOSITIVO DE EMISSÃO DE LUZ, FONTE
DE LUZ DE FUNDO E DISPLAY DE CRISTAL
LÍQUIDO
(62) PI9710792-1 29/07/1997
(71) Nichia Corporation (JP)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Anulada a decisão de indeferimento, item 9.2 ,da
RPI 2104 de 03/05/2011 por ter sido indevida.
(21) PI 0006664-8 A2 (22) 21/11/2000 9.2.1
(54) MÉTODO PARA A MEDIDA DA ASSINATURA
MULTIDIRECIONAL DE CAMPO REMOTO A
PARTIR DE LEVANTAMENTOS SÍSMICOS
(71) Petroleo Brasileiro S.A - Petrobras (BR/RJ)
(74) Antonio Claudio Correa Meyer Sant'Anna
Anulada a decisão de indeferimento, item 9.2 ,da
RPI 2104 de 03/05/2011 por ter sido indevida.
9.2.4
MANUTENÇÃO DO
INDEFERIMENTO
(21) MU 8100060-0 U2 (22) 10/01/2001 9.2.4
(54) DISPOSIÇÃO EM LABORATÓRIO DIDÁTICO
MÓVEL
(71) Autolabor Indústria e Comércio LTDA. (BR/SC)
(74) Fabrycio da Silva Raupp
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) MU 8101681-6 U2 (22) 06/07/2001 9.2.4
(54) DISPOSIÇÃO INTRODUZIDA EM FILTRO DE
ÁGUA DOMÉSTICO
(71) Claudio Lourenço Lorenzetti (BR/SP)
(74) Edmundo Brunner Asessoria S/C LTDA
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) MU 8201301-2 U2 (22) 07/06/2002 9.2.4
(54) PURIFICADOR DE ÁGUA COM SISTEMA DE
REFRIGERAÇÃO
(71) Ulfer Indústria e Comércio de Produtos
Eletrodomésticos LTDA. (BR/SP)
(74) David do Nascimento
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) MU 8201460-4 U2 (22) 19/06/2002 9.2.4
(54) DISPOSIÇÃO INTRODUZIDA EM FILTRO
(71) Ignácio Gorre (BR/SP)
(74) Excel Marcas e Patentes S/C Ltda
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0305793-3 A2 (22) 18/11/2003 9.2.4
(54) PROCESSO DE PRODUÇÃO DE SÍLICA
AMORFA
(71) Sama S.A. - Minerações Associadas (BR/GO)
(74) Marcia Tsuyako Asano
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0306171-0 A2 (22) 22/12/2003 9.2.4
(54) VIDRO REVESTIDO
(71) Cebrace Cristal Plano Ltda (BR/SP)
(74) Antonio Mauricio Pedras Arnaud
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0308152-4 A2 (22) 26/03/2003 9.2.4
(54) FIOS DE REFORÇO, COMPOSIÇÃO PARA O
ENCOLAMENTO DE FIOS DE REFORÇO, E,
COMPÓSITO
(71) Saint-Gobain Vetrotex France S.A. (FR)
(74) Momsen, Leonardos & Cia
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0314145-4 A2 (22) 09/09/2003 9.2.4
(54) IMPLEMENTAÇÃO DE COMPONENTES
MICRO-FLUÍDICOS EM UM SISTEMA MICROFLUÍDICO
(71) Cytonome, Inc. (US)
(74) Nellie Anne Daniel Shores
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0317248-1 A2 (22) 02/09/2003 9.2.4
(54) SISTEMA DE REATOR COM TUBO DE
TIRAGEM COM FILTRAGEM NO LOCAL
(71) Arco Chemical Technology, L. P (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0401922-9 A2 (22) 08/06/2004 9.2.4
(54) ESTAÇÃO DE TRATAMENTO DE ÁGUA
RESIDENCIAL
(71) Domingos Sávio Antonio de Oliveira (BR/RJ) ,
Junot Abi-Ramia Antonio (BR/RJ)
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 9809351-7 A2 (22) 14/04/1998 9.2.4
(54) TECIDO DE BAINHA DÉRMICA NA CURA DE
LESÕES
(71) Colin Albert Buchanan Jahoda (GB) , University
Of Durham (GB) , The Centre of Excellence for Life
Sciences Limited (GB)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 9900604-9 A2 (22) 23/03/1999 9.2.4
(54) AGENTE DESINFETANTE AQUOSO
CONTENDO ÁCIDO PERFÓRMICO E ÁCIDO
PERACÉTICO, PROCESSO PARA PRODUÇÃO E
USO DO MESMO
(71) Degussa GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 9902245-1 A2 (22) 11/06/1999 9.2.4
(54) ESPIRO [PIPERIDINA-4,1'-PIRROLO[3,4C]PIRROL]
(71) F. Hoffmann-La Roche AG (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 9917753-6 A2 (22) 21/06/1999 9.2.4
(54) DERIVADOS DE EPOTILONA, FORMULAÇÃO
E COMPOSIÇÃO FARMACÊUTICAS
COMPREENDENDO OS MESMOS, SEU USO,
BEM COMO SEUS MÉTODOS DE SÍNTESE
(71) Novartis Ag (Novartis SA) (Novartis INC.) (CH) ,
The Scripps Research Institute (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0001121-5 A2 (22) 04/04/2000 9.2.4
(54) SENSOR POTENCIOMETRICO PARA
DETERMINACÃO DE DOPAMNA E DERIVADOS
EMPREGANDO SISTEMA DE ANALISE POR
INJEÇÃO EM FLUXO
132
DIRPA - Despachos Relativos a Pedidos e Patentes
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Edson César dos Santos Cabral
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0004447-4 A2 (22) 26/09/2000 9.2.4
(54) JUNÇÃO EXTRUDÁVEL PARA
PNEUMÁTICOS RECAUCHUTADOS
(71) The Goodyear Tire & Rubber Company (US)
(74) DANIEL & CIA
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0005068-7 A2 (22) 23/08/2000 9.2.4
(54) SISTEMA PARA ANÁLISE SELETIVA DE
FENÓIS E SEUS DERIVADOS EM ÁGUA
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Edson César dos Santos Cabral
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0013308-6 A2 (22) 10/08/2000 9.2.4
(54) MÉTODO DE REDUÇÃO DA
PERMEABILIDADE A GASES DE FILMES,
FOLHAS E RECIPIENTES POLIMÉRICOS,
COMPOSIÇÃO DE POLÍMERO E ARTIGO
MANUFATURADO
(71) INVISTA Technologies S.à.r.l. (CH)
(74) Ana Paula Santos Celidonio
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0016529-8 A2 (22) 24/11/2000 9.2.4
(54) COMPOSIÇÃO DETERGENTE PARA LAVAR
ROUPA, MÉTODO PARA A PROTEÇÃO DE
TECIDOS TÊXTEIS NOVOS BRANCOS OU DE
COR CLARA CONTRA A DEGRADAÇÃO DA COR
DURANTE A LAVAGEM, E, USO DE UM
POLÍMERO SOLÚVEL EM ÁGUA
(71) Unilever N.V (NL)
(74) Atem & Remer Asses. Consul. Prop. Int. Ltda
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0102823-5 A2 (22) 30/05/2001 9.2.4
(54) PROCESSO DE FABRICAÇÃO DE ADESIVO
PARA SUPERFICÍES DE VIDROS, CERÂMICAS,
ALVENARIAS E PLÁSTICOS À BASE DE LÁTEX
DE BORRACHA NATURAL MODIFICADO POR
POLIFOSFATO
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0105475-9 A2 (22) 27/09/2001 9.2.4
(54) PROCESSO OBTENÇÃO DE MISTURAS DE
DIÁCIDOS ORGÂNICOS ORIUNDOS DE
FABRICAÇÃO DE ÁCIDO ADÍPICO E MISTURAS
DE DIÁCIDOS ORGÂNICOS
(71) Rhodia Poliamida América do Sul (BR/SP)
(74) Vicente de Paula Stampini
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0105888-6 A2 (22) 30/11/2001 9.2.4
(54) PROCESSO PARA PRODUÇÃO DE
BIODIESEL
(71) Petróleo Brasileiro S.A. - PETROBRAS (BR/RJ)
(74) José Cláudio Vasquez de Mesquita
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0106124-0 A2 (22) 14/12/2001 9.2.4
(54) SISTEMA DE REVESTIMENTO DE FIOS COM
ESPAÇAMENTO VARIÁVEL E ROLO DE
CONDUÇÃO MODULAR PARA O MESMO
(71) Illinois Tool Works, INC. (US)
(74) Nellie Anne Daniel Shores
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0108337-6 A2 (22) 15/01/2001 9.2.4
(54) MÉTODO DE REVESTIMENTO DE
SUPERFÍCIES DE SUBSTRATO COM
POLÍMEROS LCST
(71) Forschungsinstitut Fuer Pigment Und Lacke E.V
(DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0109424-6 A2 (22) 15/03/2001 9.2.4
(54) FORMULAÇÃO PARA AGENTE DE
EMBRANQUECIMENTO FLUORESCENTE PARA
DETERGENTES
(71) Ciba Specialty Chemicals Holding INC. (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0109730-0 A2 (22) 16/03/2001 9.2.4
(54) PROCESSO PARA FORMAÇÃO DE
PRODUTO DE CERA HIDROCARBONADA
PROVENIENTE DE GÁS DE SÍNTESE, E,
PRODUTO DE CERA HIDROCARBONADA
(71) Exxonmobil Research And Engineering
Company (US)
(74) Momsen, Leonardos & Cia.
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0109731-8 A2 (22) 13/03/2001 9.2.4
(54) PROCESSO PARA PRODUZIR UMA
COMPOSIÇÃO DE CERA DE SÍNTESE DE
HIDROCARBONETO, E, PRODUTO DE CERA DE
HIDROCARBONETO
(71) Exxonmobil Research And Engineering
Company (US)
(74) Momsen, Leonardos & Cia.
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0110271-0 A2 (22) 09/03/2001 9.2.4
(54) COMPOSIÇÕES EM FORMA DE SACO
(71) The Procter & Gamble Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0110479-9 A2 (22) 10/04/2001 9.2.4
(54) MÉTODO PARA OPERAR UM MOTOR A
DIESEL PARA PRODUZIR EMISSÕES BAIXAS,
PROCESSO PARA A PRODUÇÃO DE UM
COMBUSTÍVEL DE MOTOR A DIESEL, E,
COMBUSTÍVEL ÚTIL PARA COMBUSTÃO EM
MOTOR
(71) Exxonmobil Research And Engineering
Company (US)
(74) Momsen, Leonardos & Cia
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0111747-5 A2 (22) 22/06/2001 9.2.4
(54) PROCESSO DE MOAGEM ÚMIDA
(71) Smithkline Beecham P.L.C. (GB)
(74) Nellie Anne Daniel Shores
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
RPI 2109 de 07/06/2011
(54) COMPOSIÇÃO DE GASOLINA DESPROVIDA
DE CHUMBO, PROCESSO PARA A
PREPARAÇÃO DE UMA COMPOSIÇÃO DE
GASOLINA, E, MÉTODO DE OPERAR UM
AUTOMÓVEL ACIONADO COM UM MOTOR DE
IGNIÇÃO A CENTELHA
(71) Shell Internationale Research Maatschappij
B.V. (NL)
(74) Momsen, Leonardos & Cia.
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0201114-0 A2 (22) 28/03/2002 9.2.4
(54) PROCESSO DE EXTRAÇÃO DO TIPO
LÍQUIDO-LÍQUIDO PARA TRATAMENTO DE
EFLUENTES USANDO SISTEMA EJETOR
(71) Comissão Nacional de Energia Nuclear (BR/RJ)
(74) Júlio Cesar Capella Fonseca
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0201838-1 A2 (22) 15/05/2002 9.2.4
(54) PROCESSO DE APLICAÇÃO DO DIÓXIDO DE
CLORO ESTABILIZADO EM SOLUÇÃO AQUOSA
NA INDÚSTRIA DE ALIMENTOS, COMO
COADJUVANTE TECNOLÓGICO PARA
BRANQUEAMENTO DE MIÚDOS SALGADOS
SUÍNOS E DESCONTAMINAÇÃO DE TRIPAS,
CHARQUE E SALMOURAS
(71) Veros Produtos Quimicos LTDA. (BR/SP)
(74) Darré & Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0206898-2 A2 (22) 22/11/2002 9.2.4
(54) TUBO CONDUTOR MULTICAMADA A BASE
DE POLIAMIDA E EVOH PARA TRANSPORTE DE
GASOLINA
(71) Atofina (FR)
(74) Clarke Modet do Brasil
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0208740-5 A2 (22) 28/03/2002 9.2.4
(54) SISTEMA DE CAMADA TERMOABSORVENTE
(71) Bayer Aktiengesellschaft (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0208772-3 A2 (22) 02/04/2002 9.2.4
(54) SISTEMA DE CAMADAS ABSORVEDORAS
DE CALOR
(71) Bayer Aktiengesellschaft (DE)
(74) Dannemann, Siemsen & Ipanema Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0209346-4 A2 (22) 23/04/2002 9.2.4
(54) CONVERSOR DE DESLOCAMENTO, E,
MÉTODO DE REDUZIR A QUANTIDADE DE
MONÓXIDO DE CARBONO EM UM GÁS
COMBUSTÍVEL DE PROCESSAMENTO PARA
UMA CÉLULA DE COMBUSTÍVEL
(71) UTC Power Corporation (US)
(74) Momsen, Leonardos & Cia.
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0112914-7 A2 (22) 20/07/2001 9.2.4
(54) REVESTIMENTO DE BARREIRA
(71) Sidel (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0209584-0 A2 (22) 07/05/2002 9.2.4
(54) ADUTO CONTENDO POLIURETANO
LÍQUIDO, FORMULAÇÃO CURÁVEL POR
ENERGIA, PROCESSO PARA REVESTIR UMA
SUPERFÍCIE DE SUBSTRATO, ARTIGO OBTIDO
E MÉTODO PARA FAZER UM ADUTO TENDO
PELO MENOS UM GRUPO POLIMERIZÁVEL
ESTRUTO-TERMINAL.
(71) Dow Global Technologies INC. (US)
(74) Antonio Mauricio Pedras Arnaud
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0113377-2 A2 (22) 23/08/2001 9.2.4
(21) PI 0213387-3 A2 (22) 14/10/2002 9.2.4
RPI 2109 de 07/06/2011
(54) ÍMÃS DE TIPO FERRITA ECONÔMICOS E
COM PROPRIEDADES MELHORADAS
(71) Ugimag S.A. (FR)
(74) Dannemann , Siemsen, Bigler & Ipanema
Moreira
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0213758-5 A2 (22) 23/10/2002 9.2.4
(54) RECIPIENTE DE POLIPROPILENO E
PROCESSO PARA A SUA FABRICAÇÃO
(71) Pechiney Emballage Flexible Europe (FR)
(74) Cavalcanti e Cavalcanti Advogados
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0215496-0 A2 (22) 20/11/2002 9.2.4
(54) PROCESSO PARA A PREPARAÇÃO DE, UMA
SUPERFÍCIE DE AÇO PARA GALVANIZAÇÃO
POR IMERSÃO A QUENTE, PROCESSO PARA
GALVANIZAÇÃO POR ÚNICA IMERSÃO DE AÇO
USANDO UM ALUMÍNIO, E PRODUTO DE AÇO
CONTÍNUO
(71) Umicore (BE)
(74) Custódio de Almeida & Cia
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
(21) PI 0215691-1 A2 (22) 07/05/2002 9.2.4
(54) APARELHO PARA TRATAMENTO DE ÁGUA,
E, MÉTODO PARA ESTERILIZAR O MESMO
(71) The Coca-Cola Company (US)
(74) Momsem, Leonardos & Cia
MANTIDO O INDEFERIMENTO UMA VEZ QUE
NÃO FOI APRESENTADO RECURSO DENTRO
DO PRAZO LEGAL.
9.2.4.1
PUBLICAÇÃO ANULADA
(21) PI 0016697-9 A2 (22) 21/11/2000 9.2.4.1
(54) DISPOSITIVO PARA A LIBERAÇÃO
CONTROLADA DURANTE UM PERÍODO DE
TEMPO PROLONGADO DE UMA DROGA
DOTADA DE PROPRIEDADES
ANTIPROGESTÍNICAS
(71) Leiras Oy (FI)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
ANULADA A PUBLICAÇÃO DA MANUTENÇÃO DO
INDEFERIMENTO POR TER SIDO INDEVIDA.
11. Arquivamento
DIRPA - Despachos Relativos a Pedidos e Patentes 133
(21) PI 0009116-2 A2 (22) 16/03/2000 11.2
(71) Schering Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 0010633-0 A2 (22) 16/05/2000 11.2
(71) Krysium Advisors LTD. (GB)
(74) Momsen, Leonardos & CIA.
(21) PI 0011873-7 A2 (22) 23/06/2000 11.2
(71) Kraton Polymers Research B.V. (NL)
(74) Momsen, Leonardos & CIA.
(21) PI 0013607-7 A2 (22) 11/08/2000 11.2
(71) Calgene LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0110944-8 A2 (22) 23/05/2001 11.2
(71) AMO Groningen B.V. (NL)
(74) Magnus Aspeby
(21) PI 0202747-0 A2 (22) 10/07/2002 11.2
(71) Peronne dos Reis Jorge (BR/RS) , Clayton
Fritsche Mattos (BR/RJ)
(74) Edemar Soares Antonini
(21) PI 0203800-5 A2 (22) 10/09/2002 11.2
(71) Luiz Henrique Pereira (BR/MG)
(74) Lancaster Comercial Patentes e Marcas
(21) PI 0213415-2 A2 (22) 16/10/2002 11.2
(71) Illinois Tool Works Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
11.4
ARQUIVAMENTO - ART. 38
PARÁG. 2º DA LPI
(21) MU 8200900-7 U2 (22) 29/04/2002 11.4
(71) Fabian Mário Rao (AR)
(74) Anizio Dias de Oliveira
11.5
ARQUIVAMENTO - ART. 34 DA
LPI
(21) PI 9613009-1 A2 (22) 06/06/1996 11.5
(62) PI9608884-2 06/06/1996
(71) IDEC Pharmaceuticals Corporation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9909252-2 A2 (22) 23/12/1999 11.5
(71) Yeda Research And Development CO. LTD (IL)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
11.2
ARQUIVAMENTO - ART. 36
PARÁG. 1º DA LPI
(21) PI 0007001-7 A2 (22) 18/08/2000 11.5
(71) Grain Processing Corporation (US)
(74) Matos & Associados - Advogados
(21) PI 0506323-0 A2 (22) 22/12/2005 11.2
(71) Espólio de Gessé Arantes de Roure,
representado por Gesse de Roure Filho (BR/DF)
(74) Glenda Carvalho Rocha
(21) PI 0008738-6 A2 (22) 03/03/2000 11.5
(71) Praecis Pharmaceuticals Incorporated (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9801993-7 A2 (22) 10/06/1998 11.2
(71) At&T Wireless Services, Inc. (US)
(74) Clarke Modet do Brasil LTDA
(21) PI 0009193-6 A2 (22) 24/02/2000 11.5
(71) Societe Des Produits Nestle S.A (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9806863-6 A2 (22) 07/01/1998 11.2
(71) Telefonaktiebolaget L. M. Ericsson. (SE)
(74) Momsen, Leonardos & CIA.
(21) PI 9906755-2 A2 (22) 02/09/1999 11.2
(71) Samsung Electronics CO., Ltd. (KR)
(74) Momsen, Leonardos & CIA.
(21) PI 9913920-0 A2 (22) 23/09/1999 11.2
(71) Pharmacia & Upjohn Company (US)
(74) Clarke Modet do Brasil LTDA
(21) PI 9915672-5 A2 (22) 03/12/1999 11.2
(71) Qualcomm Incorporated (US)
(74) Montaury Pimenta, Machado & Lioce S/C Ltda.
(21) PI 9916020-0 A2 (22) 08/12/1999 11.2
(71) Corixa Corporation (US)
(74) Daniel & Cia.
(21) PI 0012917-8 A2 (22) 04/07/2000 11.5
(71) Unilever N.V. (NL)
(74) Momsen, Leonardos & Cia.
(21) PI 0013256-0 A2 (22) 14/08/2000 11.5
(71) The Folgers Coffee Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0013636-0 A2 (22) 30/06/2000 11.5
(71) Zila, INC. (US)
(74) Clarke Modet Do Brasil LTDA
(21) PI 0014213-1 A2 (22) 09/09/2000 11.5
(71) Südzucker Aktiengesellschaft
Mannheim/Ochsenfurt (DE)
(74) Di Blasi, Parente, S. G. & Associados S/C
(21) PI 0014391-0 A2 (22) 29/09/2000 11.5
(71) Jeneil Biotech, Inc. (US)
(74) Araripe & Associados
(21) PI 0014916-0 A2 (22) 13/10/2000 11.5
(71) Hickory Specialties, Incorporated (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0015163-7 A2 (22) 25/10/2000 11.5
(71) Bio Merieux (FR)
(74) Momsen , Leonardos & CIA.
(21) PI 0015549-7 A2 (22) 13/11/2000 11.5
(71) Children's Hospital Medical Center (US)
(74) Hugo Silva, Rosa, Santiago & Maldonado
(21) PI 0016304-0 A2 (22) 05/12/2000 11.5
(71) Tianjin Hualida Biotechnology Co. Ltd (CN)
(74) Antonio Mauricio Pedras Arnaud
(21) PI 0107930-1 A2 (22) 26/01/2001 11.5
(71) The Scripps Research Institute (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0107943-3 A2 (22) 26/01/2001 11.5
(71) The Scripps Research Institute (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0108697-9 A2 (22) 26/02/2001 11.5
(71) University Of Massachusetts, Public Institution
Of Higher Education Of The Commonwealth Of
Massachusetts, Represented By Its Amherst
Campus (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0109524-2 A2 (22) 23/03/2001 11.5
(71) Genetics Institute LLC. (US)
(74) Momsen, Leonardos & Cia.
(21) PI 0110474-8 A2 (22) 02/05/2001 11.5
(71) Oncolytics Biotech, INC. (CA)
(74) Momsen, Leonardos & Cia
(21) PI 0110481-0 A2 (22) 01/05/2001 11.5
(71) Oncolytics Biotech, INC. (CA)
(74) Momsen, Leonardos & Cia
(21) PI 0110676-7 A2 (22) 06/04/2001 11.5
(71) Midwest Research Institute (US)
(74) Cruzeiro/Newmarc Patentes e Marcas Ltda.
(21) PI 0110706-2 A2 (22) 18/05/2001 11.5
(71) Geneart AG (DE)
(74) Nellie Anne Daniel Shores
(21) PI 0009219-3 A2 (22) 21/03/2000 11.5
(71) Kal Kan Foods, INC. (US)
(74) Daniel & Cia
(21) PI 0110759-3 A2 (22) 11/05/2001 11.5
(71) Medvet Science PTY. LTD. (AU)
(74) Momsen, Leonardos & Cia
(21) PI 0009505-2 A2 (22) 03/04/2000 11.5
(71) Corixa Corporation (US)
(74) Daniel & Cia.
(21) PI 0111823-4 A2 (22) 20/06/2001 11.5
(71) University Of Sheffield (GB) , Biosynexus INC.
(US)
(74) Momsen, Leonardos & Cia
(21) PI 0012620-9 A2 (22) 14/07/2000 11.5
(71) The Folgers Coffee Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(21) PI 0012654-3 A2 (22) 21/07/2000 11.5
(71) Novozymes North America, Inc. (US) ,
Novozymes A/S (DK)
(74) Momsen, Leonardos & CIA.
(21) PI 0112637-7 A2 (22) 20/07/2001 11.5
(71) Glaxo Group Limited (GB)
(74) Nellie Anne Daniel Shores
(21) PI 0113619-4 A2 (22) 29/08/2001 11.5
(71) Virxsys Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
134
DIRPA - Despachos Relativos a Pedidos e Patentes
11.6.1
ARQUIVAMENTO DA PETIÇÃO ART. 216 PARÁG. 2º DA LPI
(21) PI 0518944-6 A2 (22) 18/11/2005 11.6.1
(71) Combimatrix Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Interessado: O depositante.
Despacho: Arquivada a petição de entrada na fase
nacional, uma vez que não foi apresentada a
procuração devida no prazo de 60 (sessenta) dias
contados do primeiro do ato, conforme determina o
Art. 216 da LPI. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
11.14
PUBLICAÇÃO ANULADA
(21) MU 8600917-6 U2 (22) 05/05/2006 11.14
(71) Mariana de Menezes Tedesco (BR/PR)
Referente à RPI nº 2072 de 21/09/2010, por ter sido
indevido.
(21) MU 8601926-0 U2 (22) 14/09/2006 11.14
(71) Sérgio Paulo Lacorte (BR/BA)
(74) Brasnorte Marcas e Patentes LTDA
Referente à RPI Nº 2072 de 21/09/2010, por ter sido
indevido.
(21) MU 8602746-8 U2 (22) 13/12/2006 11.14
(71) Alberto Chiguetosi Aguni (BR/SP)
(74) Roger Shinki Yafushi
Anulada a RPI 2059 de 22/06/2010. Por ter sido
indevido.
(21) PI 0602223-5 A2 (22) 28/04/2006 11.14
(71) Brscan Processamento de Dados e Tecnologia
Ltda (BR/DF)
Referente à RPI nº 2090 de 25/01/2011, por ter sido
indevido.
(21) PI 0602369-0 A2 (22) 29/05/2006 11.14
(71) Sandro Eduardo Degasperi (BR/ES)
(74) Wagner José fafá Borges
Referente à RPI nº 2090 de 25/01/2011, por ter sido
indevido.
(21) PI 0602726-1 A2 (22) 29/05/2006 11.14
(71) Rafael Gonçalves Veloso (BR/MG)
(74) Glays Marcel Costa
Referente à RPI nº 2090 de 25/01/2011, por ter sido
indevido.
(21) PI 0603159-5 A2 (22) 27/07/2006 11.14
(71) Geodete Aquino Gonçalves (BR/PR)
Referente à RPI nº 2090 de 25/01/2011, por ter sido
indevido.
(21) PI 0603648-1 A2 (22) 29/08/2006 11.14
(71) Embryo Web Solutions Ltda. (BR/SP)
(74) David Nilton Pereira de Lucena
Referente à RPI nº 2090 de 25/01/2011, por ter sido
indevido.
12. Recurso
12.2
RECURSO CONTRA O
INDEFERIMENTO
(21) MU 8002384-3 U2 (22) 19/10/2000 12.2
(71) B.S Tubos & Bombas LTDA. (BR/MG)
(74) Silva & Guimarães Marcas e Patentes Ltda.
(21) PI 9801130-8 A2 (22) 25/03/1998 12.2
(71) DSM IP Assets B.V. (NL)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
(21) PI 9814787-0 A2 (22) 08/12/1998 12.2
(71) Unilever N.V (NL)
(74) Gusmão & Labrunie S/C Ltda
(21) PI 9815122-3 A2 (22) 02/12/1998 12.2
(71) Roche Diagnostics Operations, Inc. (US)
(74) Nellie Anne Daniel Shores
15. Outros Referentes a Pedidos
RPI 2109 de 07/06/2011
(74) Nellie Anne Daniel Shores
A manifestação foi considerada não satisfatória,
uma vez que o valor pago para o exame das 45
reivindicações do pedido, não corresponde aos
valores de retribuição vigentes à época do pedido
de exame do presente pedido (realizado em
04/11/2003). Portanto, em face de todo o exposto se
desconhece a petição de pedido de exame, nº
061985 de 04/11/2003, baseando-se no artigo 218,
inciso II da LPI 9279/96.
15.7
PETIÇÃO NÃO CONHECIDA
15.10
MUDANÇA DE NATUREZA
(21) MU 8000062-2 Y1 (22) 27/01/2000 15.7
(71) CID Produtos Ltda. (BR/SC)
(74) Maria Aparecida Pereira Gonçalves
Não conhecida a petição nº 017100001237/SC de
18/08/2010 em virtude do disposto no Art. 219 inciso
II da LPI.
(21) PI 0105869-0 A2 (22) 12/11/2001 15.10
(54) DISPOSITIVO FEMININO PARA URINAR EM
PÉ
(71) Geraldo Lopes Vieira Junior (BR/SP)
(74) Somarca Assessoria Empresarial S/C Ltda.
Mudada a Natureza do PI0105869-0 para
MU8103536-5
(21) MU 8401914-0 U2 (22) 13/08/2004 15.7
(71) Luiz Carlos Camillo de Oliveira (BR/SP)
(74) Cláudio Santana da Silva
Desconhecida a petição nº 018110009440 de
17/03/2011 com base no disposto no Art. 219, II da
Lei da Propriedade Industrial, uma vez que o
requerimento de exame prioritário deve ser
formulado por petição específica, conforme Art. 5º
da Resolução 191/08.
(21) MU 8402294-9 U2 (22) 27/09/2004 15.7
(71) Antonio Pedro Siquinelli (BR/PR)
(74) Marcos Aurélio de Jesus
Da petição 015100002927 de 04/11/2010, não
conhecido o serviço de restauração, em virtude do
disposto na art. 219, inciso II, da LPI.
(21) MU 8402543-3 U2 (22) 21/10/2004 15.7
(71) Valter Domingos Amabilini (BR/SP)
(74) Dinâmica Marcas Patentes
Desconheço a petição nº 018100031939 de
30/08/2010 , com base no disposto no Art. 219, II da
Lei da Propriedade Industrial, uma vez que o
interessado não tem legitimidade para o ato.
(21) MU 8801454-1 U2 (22) 06/05/2008 15.7
(71) Clarice Eletrodomésticos Ltda. (BR/SC)
(74) Márcio Roberto Bitelbron
Desconheço a petição nº 020090086516 de
14/09/2009, com base no disposto no Art. 219, II da
Lei da Propriedade Industrial, uma vez que o
interessado não tem legitimidade para o ato.
(21) PI 0600735-0 A2 (22) 07/03/2006 15.7
(71) Itamar Carlet (BR/RS) , Aires Garbujo Tusset
(BR/RS)
(74) Norberto Pardelhas de Barcellos
Não conhecidas as petições nº 020110000791/VP
de 06/12/2010 e nº 020110000792/VP de
06/12/2010 em virtude do disposto no Art. 218 inciso
I da LPI.
(21) PI 0602836-5 B1 (22) 16/06/2006 15.7
(71) Nelson Franklin Vieira (BR/SP)
Não conhecida a petição nº 018080079571/SP de
26/12/2008 por motivo de haver petição de exame
do pedido anterior válida nos autos do processo, em
virtude do disposto no Art. 219 inciso II da LPI,
podendo ser solicitada a devolução de taxa da
petição desconhecida.
(21) PI 0603512-4 A2 (22) 05/07/2006 15.7
(71) Universidade Estadual de Londrina (BR/PR)
(74) Marinete Violin
Não conhecida a petição nº 015100002968/VP de
04/11/2010 em virtude do disposto no Art. 218 inciso
I da LPI.
(21) PI 9104776-5 B1 (22) 01/11/1991 15.7
(71) Dyno Nobel AS (NO)
(74) Momsen, Leonardos & CIA.
Desconhecida a Petição de Transferência de Titular
nº 020100080253/RJ de 27/08/2010, por ausência
de fundamentação legal, tendo em vista que a
transferência foi publicada na RPI 2107 de
24/05/2010.
(21) PI 0016510-7 A2 (22) 22/12/2000 15.7
(71) Medical Research Council (GB) , International
Aids Vaccine Initiative (US) , University Of Nairobi
(KE)
15.11
ALTERAÇÃO DE
CLASSIFICAÇÃO
(21) MU 8302149-3 U2 (22) 22/08/2003 15.11
(51) B65D 30/00 (2006.01), B65D 27/00 (2006.01),
A61F 13/00 (2006.01)
Alterada da Int. Cl.: A61F 13/00.
(21) PI 0305525-6 A2 (22) 10/11/2003 15.11
(51) G01N 7/02 (2006.01)
Alterada a Classificação de H01K 7/02 para
Int.Cl.2011.01 G01N 21/00
(21) PI 0501228-7 A2 (22) 01/04/2005 15.11
(51) H02M 1/00 (2007.01), H05B 7/144 (2006.01)
Alterada a Classificação de B23K 9/00 para Int. Cl.
2010.01 H02M 1/00, H05B 7/144
(21) PI 9806901-2 A2 (22) 12/01/1998 15.11
(51) H04W 12/06 (2009.01)
Alterada a classificação H04Q 7/38 para Int. Cl.
2011.01 H04W 12/06.
(21) PI 0101434-0 A2 (22) 10/04/2001 15.11
(51) E21B 7/15 (2006.01)
Alterada de Int. Cl. 7: E21B 7/15.
(21) PI 0106518-1 A2 (22) 14/11/2001 15.11
(51) H02P 8/40 (2006.01), B25J 9/00 (2006.01)
Alterada a Classificação de B23K 37/04 para Int.
Cl.2010.01 H02P 8/40, B25J 9/00
(21) PI 0112871-0 A2 (22) 03/08/2001 15.11
(51) C08F 220/34 (2006.01), C08F 230/06
(2006.01), G01N 31/22 (2006.01)
Alteração da classificação de C07F 5/02, C07F 5/04,
G01N 33/06 para C08F 220/34, C08F 230/06, G01N
31/22
(21) PI 0113703-4 A2 (22) 11/06/2001 15.11
(51) A61K 31/59 (2006.01), C07C 401/00 (2006.01),
A61P 19/00 (2006.01)
Para:Int.CI. A61K 31/59, C07C 401/00, A61P 19/00
(21) PI 0115224-6 A2 (22) 17/10/2001 15.11
(51) C07C 51/215 (2006.01), B01J 8/18 (2006.01),
B01J 23/652 (2006.01), C07C 53/08 (2006.01)
Para:Int.CI. C07C 51/215, B01J 8/18, B01J 23/652,
C07C 53/08
(21) PI 0206371-9 A2 (22) 19/11/2002 15.11
(51) A61K 9/16 (2006.01), A61K 9/14 (2006.01),
A61K 9/00 (2006.01), A61P 29/00 (2006.01)
Para:Int.CI: A61K 9/16, A61K 9/14, A61K 9/00,
A61P 29/00
(21) PI 0208047-8 A2 (22) 29/01/2002 15.11
(51) C10G 69/12 (2006.01), C10G 17/095 (2006.01),
C10G 29/20 (2006.01), C10G 65/06 (2006.01),
C10G 67/08 (2006.01)
Para:Int.CI. C10G 69/12, C10G 17/095, C10G
29/20, C10G 65/06, C10G 67/08
RPI 2109 de 07/06/2011
15.22
DEVOLUÇÃO DE PRAZO
CONCEDIDA
(21) PI 0301170-4 A2 (22) 01/04/2003 15.22
(71) Robson Rojas Romero (BR/SP) , Roberto
George Rozsa (BR/SP)
(74) Ana Paula Mazzei dos Santos Leite
Reconhecido o obstáculo administrativo e devolvido
o prazo de 19 dias para manifestação à ciência de
parecer, nos termos do artigo 221 parágrafo 2º da
LPI e da resolução 116/04.
(21) PI 0311785-5 A2 (22) 19/06/2003 15.22
(71) E.I. Du Pont de Nemours And Company (US)
(74) Ana Paula Santos Celidonio
Reconhecido o obstáculo administrativo e devolvido
o prazo de 15 dias para manifestação à ciência de
parecer, nos termos do artigo 221 parágrafo 2º da
LPI e da resolução 116/04.
(21) PI 0802193-7 A2 (22) 03/06/2008 15.22
(71) Wagner José da Cruz (BR/MG)
(74) Sociedade Civil Braxil Ltda
Referente à RPI 2075, de 13/10/2010, despacho
7.1, devolvo 15 (quinze) dias de prazo para
manifestação sobre o parecer técnico, contados a
partir da data desta notificação. O despositante
poderá requerer cópia do parecer através do
formulário modelo 1.05.
(21) PI 9803833-8 A2 (22) 08/10/1998 15.22
(71) Maschinenfabrik Reinhausen GMBH (US)
(74) Franco, Bhering, Barbosa e Novaes
Atendendo o solicitado através da petição nº
020110006276 de 19/01/2011,reconhecemos a justa
causa CONCEDENDO o prazo de 20 (vinte) dias ,
contados a partira da data de publicação na RPI.
(21) PI 9903162-0 A2 (22) 08/07/1999 15.22
(71) Elizabeth Paixão Dornelles (BR/RS) , Carlos
Eduardo de Oliveira Freitas (BR/RS)
(74) O Próprio
Atendendo o solicitado através da petição nº
016110001191 DERS de 11/03/2011,
reconhecemos a justa causa CONCEDENDO o
prazo de 90 (noventa) dias contados a partir da data
de publicação na RPI
(21) PI 0004738-4 A2 (22) 02/10/2000 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP) , IPT - Instituto de Pesquisas Tecnológicas
do Estado de São Paulo S/A (BR/SP)
(74) Edson Cesar dos Santos Cabral
Atendendo o solicitado através da petição nº
0181100064170 DESP de
23/02/2011,reconhecemos a justa causa,
CONCEDENDO, o prazo de 19 (dezenove) dias
contado a partir da data de publicação na RPI
(21) PI 0005888-2 A2 (22) 14/12/2000 15.22
(71) DSM IP Assets B.V. (NL)
(74) Orlando de Souza
Reconhecido o obstáculo administrativo e devolvido
o prazo de 15 (quinze) dias, nos termos do artigo
221 parágrafo 2º da LPI e da resolução 116/04.
(21) PI 0015031-2 A2 (22) 26/10/2000 15.22
(71) Plant Research International B.V. (NL)
(74) NELLIE ANNE DANIEL SHOES
Reconhecido o obstáculo administrativo e devolvido
o prazo de 35 (trinta e cinco) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0100199-0 A2 (22) 04/01/2001 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
Reconhecido o obstáculo administrativo e devolvido
o prazo de 28 (vinte e oito) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0101346-7 A2 (22) 28/03/2001 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
Reconhecido o obstáculo administrativo e devolvido
o prazo de 28 (vinte e oito) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
DIRPA - Despachos Relativos a Pedidos e Patentes 135
(21) PI 0101870-1 A2 (22) 11/04/2001 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
Reconhecido o obstáculo administrativo e devolvido
o prazo de 31 (trinta e um) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0101926-0 A2 (22) 11/04/2001 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
Reconhecido o obstáculo administrativo e devolvido
o prazo de 31 (trinta e um) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0102556-2 A2 (22) 14/05/2001 15.22
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Pedro Emerson de Carvalho
Reconhecido o obstáculo administrativo e devolvido
o prazo de 19 (dezenove) dias, nos termos do artigo
221 parágrafo 2º da LPI e da resolução 116/04.
(21) PI 0110531-0 A2 (22) 03/05/2001 15.22
(71) Kimberly-Clark Worldwide, INC. (US)
(74) Clarke Modet do Brasil Ltda
Reconhecido o obstáculo administrativo e devolvido
o prazo de 71 (setenta e um) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0112276-2 A2 (22) 22/06/2001 15.22
(71) The Government of The United States Of
America, as Represented By The Secretary of
Department of Health and Human Services (US)
(74) Luiz Antonio Ricco Nunes
Reconhecido o obstáculo administrativo e devolvido
o prazo de 25 (vinte e cinco) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0112470-6 A2 (22) 04/07/2001 15.22
(71) Ineos Europe Limited (GB)
(74) Orlando de Souza
Reconhecido o obstáculo administrativo e devolvido
o prazo de 28 dias para apresentação de recurso
contra o indeferimento, nos termos do artigo 221
parágrafo 2º da LPI e da resolução 116/04.
(21) PI 0112942-2 A2 (22) 01/08/2001 15.22
(71) DSM IP Assets B.V. (NL)
(74) Nellie Anne Daniel Shores
Reconhecido o obstáculo administrativo e devolvido
o prazo de 56 (cinqüenta e seis) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0115825-2 A2 (22) 20/12/2001 15.22
(71) Kimberly-Clark Worldwide, Inc (US)
(74) Clarke Modet do Brasil Ltda
Reconhecido o obstáculo administrativo e devolvido
o prazo de 85 (oitenta e cinco) dias, nos termos do
artigo 221 parágrafo 2º da LPI e da resolução
116/04.
(21) PI 0201666-4 A2 (22) 23/04/2002 15.22
(71) Universidade Federal de Minas Gerais (BR/MG)
Reconhecido o obstáculo administrativo e devolvido
o prazo de 19 dias para manifestação à ciência de
parecer, nos termos do artigo 221 parágrafo 2º da
LPI e da resolução 116/04.
15.22.1
DEVOLUÇÃO DE PRAZO
NEGADA
(21) PI 0520249-3 A2 (22) 21/11/2005 15.22.1
(71) Lindauer Dornier Gesellschaft MBH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Interessado: O depositante.
Despacho: Negada a solicitação de devolução de
prazo, requerida através da petição nº
020070168542 de 28/11/2007, uma vez que não
ficou comprovada a justa causa, conforme definida
no Art. 221 da LPI 9279/96 e no Art. 2º da
Resolução 254/10. A cópia do parecer poderá ser
solicitada através do formulário 1.05. Desta data
corre o prazo de 60 (sessenta) dias para eventual
recurso do interessado.
16. Concessão de Patente ou
Certificado de Adição de
Invenção
16.3
RETIFICAÇÃO
(11) PI 9912979-5 B1 (22) 06/08/1999 16.3
(30) 14/08/1998 EP 98115310.9; 11/05/1999 EP
99109430.1
(45) 21/09/2010
(51) A61K 31/365 (2006.01), A61K 47/36 (2006.01),
A61K 9/00 (2006.01), A61K 9/16 (2006.01), A61P
3/04 (2006.01)
(54) COMPOSIÇÃO FARMACÊUTICA
ADMINISTRÁVEL ORALMENTE, TABLETE DE
MASCAR E CÁPSULA PARA O TRATAMENTO DE
OBESIDADE.
(73) F. Hoffmann-La Roche AG (CH)
(72) Jacques Bailly, André Fleury, Paul Hadvary,
Hans Lengsfeld, Hans Steffen
(74) Vieira de Mello Advogados
Prazo de Validade: 10 (dez) anos contados a partir
de 21/09/2010, observadas as condições legais.
Referente a RPI 2072 de 21/09/2010, Código do
Despacho (16.1), item (54) Título. Onde se lê:
COMPOSIÇÃO FARMACÊUTICA ADMINISTRÁVEL
ORALMENTE, TABLETE DE MASCAR, CÁPSULA
E USO DE CHITOSAN. Leia-se: COMPOSIÇÃO
FARMACÊUTICA ADMINISTRÁVEL ORALMENTE,
TABLETE DE MASCAR E CÁPSULA PARA O
TRATAMENTO DE OBESIDADE.
19. Notificação de Decisão
Judicial
19.1
NOTIFICAÇÃO DE DECISÃO
JUDICIAL
(11) PP 1100593-9K B1 (45) 02/04/2002 19.1
(73) Karl Thomae GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
INPI-52400.000708/06
Seção Judiciária do Rio do Janeiro - 39ª Vara
Federal
Processo nº: 2005.51.01.527211-0
Recurso Especial nº 1.165.845
Recorrente: DR KARL THOMAE GMBH
Recorrido: INSTITUTO NACIONAL DE
PROPRIEDADE INDUSTRIAL – INPI
Decisão: A Turma, por unanimidade, conheceu em
parte do recurso especial e, nesta parte, negou-lhe
provimento, nos termos do voto do Sr. Ministro
Relator.
(11) PP 1100678-1K B1 (45) 13/10/1999 19.1
(73) Dr. Karl Thomae GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
INPI-52400.000708/06
Seção Judiciária do Rio do Janeiro - 39ª Vara
Federal
Processo nº: 2005.51.01.527211-0
Recurso Especial nº 1.165.845
Recorrente: DR KARL THOMAE GMBH
Recorrido: INSTITUTO NACIONAL DE
PROPRIEDADE INDUSTRIAL - INPI
Decisão: A Turma, por unanimidade, conheceu em
parte do recurso especial e, nesta parte, negou-lhe
provimento, nos termos do voto do Sr. Ministro
Relator.
136
DIRPA - Despachos Relativos a Pedidos e Patentes
21. Extinção de Patente e
Certificado de Adição de
Invenção
21.6
EXTINÇÃO - ART. 78 INCISO IV
DA LPI
(11) PI 9702837-1 B1 (45) 30/04/2002 21.6
(73) Carlos Alberto Schnetzler Machado (BR/SP) ,
Nelson Routh Júnior (BR/SP) , João Francisco
Gomes Pinto (BR/SP)
(74) Vilage Marcas & Patentes S/C LTDA
Referente ao despacho publicado na RPI 2014 de
11/08/2009 e à 13ª e 14ª anuidades.
24. Anuidade de Patente
24.3
NOTIFICAÇÃO DA EXTINÇÃO
DA PATENTE PARA FINS DA
RESTAURAÇÃO NOS TERMOS
DO ART. 87 DA LPI
(11) MU 7601306-5 Y1 (45) 06/02/2001 24.3
(73) Claudio Carneiro (BR/SP)
(74) Sul América Marcas e Patentes S/C Ltda.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) MU 7601902-0 Y1 (45) 16/09/2003 24.3
(73) Pedro Paulo da Luz (BR/RS)
Referente 14a. anuidade(s).
(11) PI 9603116-6 B1 (45) 20/03/2001 24.3
(73) Hutchinson (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 11ª , 12ª , 13ª , 14ª e 15ª anui dades.
(11) PI 9603133-6 B1 (45) 22/08/2000 24.3
(73) Castrip, LLC (US)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
referente á 7ª , 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9603135-2 B1 (45) 09/12/2003 24.3
(73) Xerox Corporation (US)
(74) Momsen, Leonardos & Cia.
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9603136-0 B1 (45) 17/04/2001 24.3
(73) Lg Electronics Inc (KR)
(74) Daniel & Cia
referente á 12ª , 13ª , 14ª e 15ª anuidades.
(11) PI 9603145-0 B1 (45) 13/05/2003 24.3
(73) Petróleo Brasileiro S.A. - PETROBRÁS (BR/RJ)
(74) Antonio Claudio Correa Meyer Sant'Anna
Referente 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9603146-8 B1 (45) 03/02/2004 24.3
(73) Arco Chemical Technology, L.P. (US)
(74) Clarke Modet do Brasil Ltda.
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9603147-6 B1 (45) 11/10/2005 24.3
(73) Bernhard Mittelhaeuser (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9603148-4 B1 (45) 05/07/2005 24.3
(73) Basf Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 10ª,11ª,12ª,13ª, 14ª e 15ª anuidades
(11) PI 9603151-4 B1 (45) 20/07/2004 24.3
RPI 2109 de 07/06/2011
(73) Morton International, Inc. (US)
(74) Momsen, Leonardos & Cia.
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(73) Westinghouse Air Brake Company (US)
(74) Clarke Modet do Brasil LTDA
referente a 6ª,7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidades
(11) PI 9603154-9 B1 (45) 28/10/2003 24.3
(73) Johnson & Johnson (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9603254-5 B1 (45) 15/08/2006 24.3
(73) Bayer Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9603156-5 B1 (45) 26/12/2000 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9603255-3 B1 (45) 21/08/2001 24.3
(73) Daimlerchrysler AG (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9603162-0 B1 (45) 30/04/2002 24.3
(73) Praxair Technology, Inc. (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603163-8 B1 (45) 19/03/2002 24.3
(73) Kawasaki Steel Corporation (JP)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603258-8 B1 (45) 19/02/2002 24.3
(73) L'Oreal (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9603259-6 B1 (45) 22/08/2000 24.3
(73) Pechiney Rhenalu (FR)
(74) Momsen, Leonardos & CIA.
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9603174-3 B1 (45) 16/08/2005 24.3
(73) Institut Français du Petrole (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9603272-3 B1 (45) 17/10/2000 24.3
(73) Fischerwerke Artur Fischer Gmbh & Co. Kg
(DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9603177-8 B1 (45) 14/11/2000 24.3
(73) John Derek Guest (GB)
(74) Momsen, Leonardos & CIA.
Referente a 8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603274-0 B1 (45) 20/08/2002 24.3
(73) Amway Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 14ª anuidade(s).
(11) PI 9603178-6 B1 (45) 23/10/2007 24.3
(73) Agrevo UK Limited (GB)
(74) Momsen, Leonardos & Cia.
Referente a 14ª e 15ª anuidade(s).
(11) PI 9603275-8 B1 (45) 12/12/2000 24.3
(73) Bobst S.A. (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9603183-2 B1 (45) 17/02/2004 24.3
(73) Dow Corning Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9603277-4 B1 (45) 20/03/2001 24.3
(73) Westinghouse Air Brake Company (US)
(74) Clarke Modet do Brasil LTDA
Referente à 14ª anuidade(s).
(11) PI 9603186-7 B1 (45) 13/04/2004 24.3
(73) Arco Chemical Technology, L.P. (US)
(74) Clarke Modet do Brasil Ltda.
referente a 12ª,13ª,14ª e 15ª anuidades
(11) PI 9603322-3 B1 (45) 24/05/2005 24.3
(73) Sedepro (FR)
(74) Momsen, Leonardos & Cia.
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9603198-0 B1 (45) 21/06/2005 24.3
(73) Samsung Electronics Co., Ltd. (KR)
(74) Daniel & Cia.
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9603323-1 B1 (45) 13/05/2003 24.3
(73) Kawasaki Steel Corporation (JP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 14ª anuidade(s).
(11) PI 9603199-9 B1 (45) 02/03/2004 24.3
(73) Samsung Electronics Co., LTD. (KR)
(74) Daniel & Cia.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9603200-6 B1 (45) 15/02/2005 24.3
(73) Samsung Electronics Co., Ltd. (KR)
(74) Daniel & Cia.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9603203-0 B1 (45) 13/04/2004 24.3
(73) Agip Petroli S.P.A. (IT)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9603206-5 B1 (45) 05/07/2005 24.3
(73) Air Products and Chemicals, Inc. (US)
(74) Paulo C. Oliveira & Cia.
Referente a 14ª e 15ª anuidade(s).
(11) PI 9603226-0 B1 (45) 20/07/2004 24.3
(73) Deere & Company (US)
(74) Momsen, Leonardos & Cia.
referente a 13ª,14ª e 15ª anuidades
(11) PI 9603231-6 B1 (45) 20/03/2001 24.3
(11) PI 9603329-0 B1 (45) 29/03/2005 24.3
(73) Ormat Industries Ltd. (IL)
(74) Flávia Salim Lopes
Referente à 13ª e 14ª anuidade(s).
(11) PI 9603333-9 B1 (45) 10/07/2001 24.3
(73) Mario Jorge Leite Bandarra (BR/RS)
(74) Araripe & Associados
Referente à 12ª, 13ª e 14ª anuidade(s).
(11) PI 9603348-7 B1 (45) 03/04/2001 24.3
(73) Elpatronic AG (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9603367-3 B1 (45) 20/03/2001 24.3
(73) Eduardo Alves Tinoco Soares (BR/SP)
(74) Tinoco Soares & Filho S/C Ltda.
Referente 10a.,11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9603378-9 B1 (45) 05/03/2003 24.3
(73) Bernhard Mittelhaeuser (DE)
RPI 2109 de 07/06/2011
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9603379-7 B1 (45) 13/04/2004 24.3
(73) Bayer Aktiengesellschaft (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9603381-9 B1 (45) 08/07/2003 24.3
(73) Basf Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 9ª , 10ª , 11ª , 12ª e 13ª anui dades.
(11) PI 9603387-8 B1 (45) 13/05/2003 24.3
(73) Colgate-Palmolive Company (US)
(74) Momsen, Leonardos & Cia.
referente á 10ª ., 12ª , 13ª , 14ª e 15ª anui dades.
(11) PI 9603403-3 B1 (45) 20/02/2001 24.3
(73) Eastman Kodak Company (US)
(74) Momsen, Leonardos & CIA.
referente á 7ª , 8ª ,9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9603406-8 B1 (45) 02/03/2004 24.3
(73) LG Electronics Inc. (KR)
(74) Daniel & Cia.
referente á 14ª e 15ª anuidades.
(11) PI 9603418-1 B1 (45) 28/05/2002 24.3
(73) Seta S.A. - Extrativa Tanino de Acácia (BR/RS)
(74) Custódio de Almeida & Cia
referente a 10ª, 11ª,12ª,13ª, 14ª e 15ª anuidades
(11) PI 9603419-0 B1 (45) 21/08/2001 24.3
(73) Seta S.A. - Extrativa Tanino de Acácia (BR/RS)
(74) Custódio de Almeida & Cia
referente a 10ª, 11ª,12ª,13ª, 14ª e 15ª anuidades
DIRPA - Despachos Relativos a Pedidos e Patentes 137
referente á 14ª e 15ª ,, anuidades.
(11) PI 9603492-0 B1 (45) 17/10/2000 24.3
(73) Sanyo Electric Co. Ltd (JP)
(74) Momsen, Leonardos & CIA.
referente á 14ª e 15ª ,, anuidades.
(11) PI 9603494-7 B1 (45) 28/09/2004 24.3
(73) Kurita Water Industries Ltd. (JP)
(74) Araripe & Associados
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9603499-8 B1 (45) 14/05/2002 24.3
(73) Keiper GmbH & Co. (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 14ª e 15ª ,, anuidades.
(11) PI 9603510-2 B1 (45) 25/04/2006 24.3
(73) Degussa - Huels Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 11ª , 12ª , 13ª , 14ª e 15ª anui dades.
(11) PI 9603517-0 B1 (45) 11/06/2002 24.3
(73) Carlo Marcone Silva Rabelo (BR/MG)
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9603524-2 B1 (45) 20/03/2001 24.3
(73) Usinas Siderúrgicas de Minas Gerais S/AUSIMINAS (BR/MG)
(74) Sidon Clévio Pimenta Etrusco
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9603525-0 B1 (45) 07/08/2001 24.3
(73) Usinas Siderúrgicas de Minas Gerais S/A USIMINAS (BR/MG)
(74) Luiz Octávio Barros de Souza
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 13ª e 14ª anuidades
(11) PI 9603620-6 B1 (45) 05/03/2003 24.3
(73) Cryovac, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 11ª,12ª,13ª e 14ª anuidades
(11) PI 9603621-4 B1 (45) 03/09/2002 24.3
(73) Corning Incorporated (US)
(74) Tavares & Companhia
referente a 8ª,9ª,10ª,11ª,12ª 11ª,12ª,13ª e 14ª
anuidades
(11) PI 9603622-2 B1 (45) 23/01/2001 24.3
(73) Lucas Industries Public Limited Company (GB)
(74) Momsen, Leonardos & CIA.
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603634-6 B1 (45) 28/05/2002 24.3
(73) Johnson & Johnson (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 13ª e 14ª anuidades
(11) PI 9603635-4 B1 (45) 24/07/2001 24.3
(73) SMS Schloemann-Siemag Aktiengesellschaft
(DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 12ª, 13ª e 14ª anuidades
(11) PI 9603645-1 B1 (45) 23/01/2001 24.3
(73) Windmoeller & Hoelscher (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 6ª,7ª,8ª,9ª,10ª,11ª,12ª, 13ª e 14ª
anuidades
(11) PI 9603427-0 B1 (45) 03/10/2000 24.3
(73) Schafer Hydroforming GmbH & Co (DE)
(74) Clarke Modet do Brasil LTDA
referente á 12ª , 13ª , 14ª e 15ª anuidades.
(11) PI 9603543-9 B1 (45) 05/07/2005 24.3
(73) Praxair Technology, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 14a. e 15a. anuidade(s).
(11) PI 9603647-8 B1 (45) 14/11/2000 24.3
(73) LG Electronics Inc (KR)
(74) Daniel & Cia
Referente à 13ª e 14ª anuidade(s).
(11) PI 9603437-8 B1 (45) 31/10/2000 24.3
(73) TRW Inc (US)
(74) Momsen, Leonardos & CIA.
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603549-8 B1 (45) 08/07/2003 24.3
(73) YKK Corporation (JP)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 14a. e 15a. anuidade(s).
(11) PI 9603652-4 B1 (45) 03/04/2001 24.3
(73) Carl Freudenberg (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9603441-6 B1 (45) 19/03/2002 24.3
(73) Coronet-Werke GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603550-1 B1 (45) 23/01/2001 24.3
(73) Degussa - Hüls Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9603656-7 B1 (45) 20/03/2001 24.3
(73) Scies Miniatures S.A. (CH)
(74) Bhering Advogados
Referente à 6ª, 7ª, 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9603552-8 B1 (45) 20/03/2001 24.3
(73) Westinghouse Air Brake Company (US)
(74) Clarke Modet do Brasil LTDA
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9603676-1 B1 (45) 19/03/2002 24.3
(73) Otto Bock Orthopaedische Industrie Besitz- und
Verwaltungs-Kommanditgesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 7ª, 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9603446-7 B1 (45) 28/09/2004 24.3
(73) Schäfer Hydroforming GmbH & Co. (DE)
(74) Orlando de Souza
referente a 12ª, 13ª, 14ª e 15ª anuidades
(11) PI 9603447-5 B1 (45) 03/04/2001 24.3
(73) Thyssen Stahl Aktiengesellschaft (DE) , Usinor
(FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 10ª,11ª,12ª, 13ª, 14ª e 15ª anuidades
(11) PI 9603452-1 B1 (45) 22/01/2002 24.3
(73) Ciba Specialty Chemicals Holding INC. - Ciba
Spezialitätenchemie Holding AG - Ciba Spécialités
Chimiques Holding SA (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 11ª,12ª, 13ª, 14ª e 15ª anuidades
(11) PI 9603453-0 B1 (45) 22/04/2008 24.3
(73) Clariant Finance (BVI) Limited (VG)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 14ª e 15ª anuidade(s).
(11) PI 9603558-7 B1 (45) 30/10/2001 24.3
(73) Carrier Corporation (US)
(74) Momsen, Leonardos & CIA.
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9603562-5 B1 (45) 23/01/2001 24.3
(73) FMC Corporation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 11a., 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9603587-0 B1 (45) 19/06/2007 24.3
(73) Enichem S.p.A. (IT)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 14ª e 15ª anuidade(s).
(11) PI 9603601-0 B1 (45) 15/05/2001 24.3
(73) Carrier Corporation (US)
(74) Momsen, Leonardos & CIA.
referente a 9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9603474-2 B1 (45) 06/07/2004 24.3
(73) Arco Chemical Technology, L.P. (US)
(74) Orlando de Souza
referente a 14ª e 15ª anuidade
(11) PI 9603608-7 B1 (45) 22/08/2000 24.3
(73) Didion Manufacturing Company (US)
referente a 10ª e 13ª anuidades
(11) PI 9603491-2 B1 (45) 13/05/2003 24.3
(73) Clariant Produkte (Deutschland) GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(11) PI 9603613-3 B1 (45) 20/02/2001 24.3
(73) Petri Aktiengesellschaft (DE) , MC Micro
Compact Car Aktiengesellschaft (CH) ,
Daimlerchrysler Ag (DE)
(11) PI 9603776-8 B1 (45) 12/06/2001 24.3
(73) Praxair Surface Technologies do Brasil LTDA
(BR/PR)
(74) Brasil Sul Marcas e Patentes S/C Ltda.
Referente a 8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9603859-4 B1 (45) 25/09/2007 24.3
(73) Usinas Siderúrgicas de Minas Gerais S.A. USIMINAS (BR/MG)
(74) Manoel Jayme Nunes
Referente à 13ª e 14ª anuidade(s).
(11) PI 9604009-2 B1 (45) 29/01/2008 24.3
(73) L'Oreal (FR)
(74) Carolina Nakata
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9604010-6 B1 (45) 29/01/2008 24.3
(73) L'Oreal (FR)
(74) Carolina Nakata
Referente 14a. e 15a. anuidade(s).
(11) PI 9604012-2 B1 (45) 15/05/2001 24.3
(73) Emicol Eletro Eletrônica S/A (BR/SP)
(74) Advocacia Pietro Ariboni S/C
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
138
DIRPA - Despachos Relativos a Pedidos e Patentes
(11) PI 9604019-0 B1 (45) 15/02/2005 24.3
(73) Rhone-Poulenc Chimie (FR)
(74) Ana Paula Santos Celidonio
referente a 12ª,13ª, 14ª e 15ª anuidades
(11) PI 9604020-3 B1 (45) 03/01/2006 24.3
(73) Rhone Poulenc Chimie (FR)
(74) Francisco Carlos Rodrigues Silva
referente a 14ª e 15ª anuidades
(11) PI 9604032-7 B1 (45) 26/12/2000 24.3
(73) LG Electronics Inc. (KR)
(74) Pinheiro Neto - Advogados
Referente a 6ª,7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9604035-1 B1 (45) 06/02/2001 24.3
(73) Multibrás S/A Eletrodomésticos (BR/SP)
(74) Paulo Sérgio Scatamburlo
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(74) Momsen, Leonardos & Cia.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9604167-6 B1 (45) 08/07/2003 24.3
(73) Fibrasa S/A Embalagens (BR/ES)
(74) Sul América Marcas e Patentes S/C Ltda.
Referente a 8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9606883-3 B1 (45) 06/08/2002 24.3
(73) Robert Bosch GMBH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9604186-2 B1 (45) 22/01/2002 24.3
(73) Kudu Industries INC. (CA)
(74) Waldemar do Nascimento Júnior
Referente a 6ª,7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9604187-0 B1 (45) 20/03/2001 24.3
(73) Kudu Industries Inc. (CA)
(74) Waldemar do Nascimento Júnior
Referente a 6ª,7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9604042-4 B1 (45) 21/08/2001 24.3
(73) L'Oreal (FR)
(74) Francisco Carlos Rodrigues Silva
referente a 13ª, 14ª e 15ª anuidades
(11) PI 9604189-7 B1 (45) 27/11/2001 24.3
(73) Multibrás S.A. Eletrodomésticos (BR/SP)
(74) Paulo Sérgio Scatamburlo
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9604074-2 B1 (45) 10/10/2006 24.3
(73) Multibrás S.A. Eletrodomésticos (BR/SP)
(74) Antonio Mauricio Pedras Arnaud
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9604215-0 B1 (45) 27/05/2003 24.3
(73) Produtos Elétricos Palley Ltda. (BR/SP)
(74) Tinoco Soares & Filho S/C Ltda.
Referente à 9ª, 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9604087-4 B1 (45) 03/04/2001 24.3
(73) Illinois Tool Works, Inc. (US)
(74) Luis Antonio Ricco Nunes
Referente 14a. e 15a. anuidade(s).
(11) PI 9606541-9 B1 (45) 04/02/2003 24.3
(73) Daewoo Electronics CO., LTD. (KR)
(74) Momsen, Leonardos & Cia.
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9604089-0 B1 (45) 30/01/2007 24.3
(73) L'Oreal (FR)
(74) Gusmão & Labrunie S/CLtda
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9604091-2 B1 (45) 21/08/2001 24.3
(73) Multibrás S. A. Eletrodomésticos (BR/SP)
(74) Paulo Sérgio Scatamburlo
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª a
nuidades.
(11) PI 9604108-0 B1 (45) 20/03/2001 24.3
(73) Jorge Luis Beritich (AR)
(74) Octavio & Perocco S/C Ltda.
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9604111-0 B1 (45) 11/04/2006 24.3
(73) SSZK Empreendimentos Participações Ltda.
(BR/SP)
(74) Beérre Assessoria Empresarial S/C Ltda.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9604113-7 B1 (45) 14/11/2000 24.3
(73) Brudden Equipamentos Ltda. (BR/SP)
(74) Osmar Sanches Braccialli
Referente a 11,ª12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9604136-6 B1 (45) 06/05/2008 24.3
(73) ASK Industries S.p.A. (IT)
(74) Paulo Sérgio Scatamburlo
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9604142-0 B1 (45) 21/08/2001 24.3
(73) Guilherme Wolf Lebrão (BR/SP) , Gustavo
Moacir Razzante Filho (BR/SP)
(74) P.A. Produtores Associados Marcas e Patentes
Ltda
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9604153-6 B1 (45) 23/01/2001 24.3
(73) ITW Befestigungssysteme GmbH (DE)
(74) Paulo Sérgio Scatamburlo
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9604155-2 B1 (45) 15/05/2001 24.3
(73) Pedro Antonio Rosa (BR/SP)
(74) Seta Marcas e Patentes Ltda.
Referente a 5ª,6ª,7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9604157-9 B1 (45) 27/04/2004 24.3
(73) Marcio dos Santos (BR/SP)
(74) Icamp Assessoria Empresarial S/C Ltda.
RPI 2109 de 07/06/2011
(11) PI 9606548-6 B1 (45) 25/11/2003 24.3
(73) Dow Agrosciences LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 12ª,13ª, 14ª e 15ª anuidades
(11) PI 9606559-1 B1 (45) 17/09/2002 24.3
(73) Saint-Gobain Vitrage (FR)
(74) Momsen, Leonardos & Cia.
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9606561-3 B1 (45) 20/03/2001 24.3
(73) Roll Systems, Inc. (US)
(74) Momsen, Leonardos & CIA.
Referente 6a., 7a., 8a., 9a., 10a., 11a., 12a., 13a.,
14a. e 15a. anuidade(s).
(11) PI 9606563-0 B1 (45) 24/12/2002 24.3
(73) Invista Technologies S.à.r.l. (US)
(74) Ana Paula Santos Celidonio
Referente à 12ª, 13ª e 14ª anuidade(s).
(11) PI 9606573-7 B1 (45) 12/11/2002 24.3
(73) Giesecke & Devrient GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 9ª, 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9606575-3 B1 (45) 13/11/2001 24.3
(73) Societe Mediterranneenne D'Aerosols (FR)
(74) Antonio Mauricio Pedras Arnaud
Referente 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9606593-1 B1 (45) 05/08/2003 24.3
(73) Toho Titanium CO., LTD. (JP)
(74) Momsen, Leonardos & Cia.
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9606613-0 B1 (45) 13/05/2003 24.3
(73) L'Oreal (FR)
(74) Momsen, Leonardos & Cia.
Referente 11a., 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9606893-0 B1 (45) 14/10/2003 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9607053-6 B1 (45) 20/03/2001 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9607063-3 B1 (45) 15/05/2001 24.3
(73) Diego Blazquez Garcia (ES)
(74) Tinoco Soares & Filhos S/C Ltda
referente á 6ª , 7ª , 8ª , 9ª , 10ª , 11ª , 12ª ,
14ª e 15ª anui dades.
13ª ,
(11) PI 9607156-7 B1 (45) 12/11/2002 24.3
(73) Robert Bosch GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9607297-0 B1 (45) 20/02/2001 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9607323-3 B1 (45) 03/04/2001 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9607566-0 B1 (45) 03/09/2002 24.3
(73) Carrier Corporation (US)
(74) Momsen, Leonardos & Cia.
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9609505-9 B1 (45) 18/09/2001 24.3
(73) Brupat Limited (GB)
(74) Momsen, Leonardos & CIA.
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9609544-0 B1 (45) 05/03/2002 24.3
(73) Metal Storm Limited (AU)
(74) Tinoco Soares & Filho S/C Ltda.
referente á 14ª e 15ª anuidades.
(11) PI 9609557-1 B1 (45) 22/07/2003 24.3
(73) Henkel Corporation (US)
(74) Momsen, Leonardos & Cia.
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9609591-1 B1 (45) 28/05/2002 24.3
(73) Ernst Keller (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 7ª, 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9609679-9 B1 (45) 13/04/2004 24.3
(73) Ericsson Inc. (US)
(74) Momsen, Leonardos & Cia.
Referente a 10ª,11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9606629-6 B1 (45) 24/12/2002 24.3
(73) Baxter International Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9609681-0 B1 (45) 16/09/2003 24.3
(73) Rendel B.V. (NL)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 14ª e 15ª anuidade(s).
(11) PI 9606632-6 B1 (45) 24/12/2002 24.3
(73) Astra Aktiebolag (SE)
(11) PI 9609725-6 B1 (45) 14/05/2002 24.3
(73) Denel (proprietary) Limited (ZA)
RPI 2109 de 07/06/2011
(74) Momsen, Leonardos & CIA.
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9609745-0 B1 (45) 27/05/2003 24.3
(73) Eastman Chemical Company (US)
(74) Momsen, Leonardos & Cia.
referente a 15ª anuidade
(11) PI 9609746-9 B1 (45) 14/10/2003 24.3
(73) Eastman Chemical Company (US)
(74) Momsen, Leonardos & Cia.
referente a 15ª anuidade
(11) PI 9609754-0 B1 (45) 11/11/2003 24.3
(73) Minnesota Mining and Manufacturing Company
(US)
(74) Momsen, Leonardos & Cia.
referente a 11ª,12ª,13ª, 14ª e 15ª anuidades
(11) PI 9609808-2 B1 (45) 03/09/2002 24.3
(73) Gesellschaft Zur Foerderung Der
Spektrochemie Und Angewandten Spektroskopie
E.V. (DE) , Laboratorio Central - Lac Convenio
Copel e UFPR (BR/PR) , Laboratorio Central - Lac
Convenio Copel e UFPR (BR/PR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9609810-4 B1 (45) 14/11/2000 24.3
(73) Mannesmann Aktiengellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 8ª,9ª10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9609814-7 B1 (45) 15/10/2002 24.3
(73) ZF Meritor, LLC (US)
(74) Paulo Sérgio Scatamburlo
referente a 14ª e 15ª anuidades
(11) PI 9609819-8 B1 (45) 30/04/2002 24.3
(73) Mannesmann Aktiengellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9609824-4 B1 (45) 28/05/2002 24.3
(73) Mannesmann Aktiengesellschaft (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 8ª,9ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9609825-2 B1 (45) 23/07/2002 24.3
(73) Siemens Aktiengesellschaft (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9609827-9 B1 (45) 30/04/2002 24.3
(73) Robert Bosch GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9609828-7 B1 (45) 10/07/2001 24.3
(73) ZF Meritor , LLC (US)
(74) Clark Modet do Brasil LTDA
referente a 14ª e 15ª anuidades
(11) PI 9609833-3 B1 (45) 09/07/2002 24.3
(73) Viasat, Inc. (US)
(74) Nellie Anne Daniel Shores
referente a 8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidades
(11) PI 9609835-0 B1 (45) 20/08/2002 24.3
(73) Telefonaktiebolaget L M Ericsson (SE)
(74) Momsen, Leonardos & Cia.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9609843-0 B1 (45) 23/12/2003 24.3
(73) Kimberly-Clark Worldwide, Inc. (US)
(74) Clarke Modet do Brasil Ltda.
referente a 12ª,13ª, 14ª e 15ª anuidades
(11) PI 9609848-1 B1 (45) 20/08/2002 24.3
(73) ZF Meritor, LLC (US)
(74) Paulo Sérgio Scatamburlo
referente a 14ª e 15ª anuidades
DIRPA - Despachos Relativos a Pedidos e Patentes 139
(11) PI 9609854-6 B1 (45) 27/05/2003 24.3
(73) Ctech AG (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9609864-3 B1 (45) 03/09/2002 24.3
(73) Day International, Inc. (US)
(74) Di Blasi, Parente, S. G. & Associados S/C
Referente 14a. e 15a. anuidade(s).
(11) PI 9609877-5 B1 (45) 11/04/2006 24.3
(73) Vesuvius France S.A (FR)
(74) Momsen, Leonardos & Cia.
Referente 15a. anuidade(s).
(11) PI 9609885-6 B1 (45) 03/09/2002 24.3
(73) Hill-Rom, Inc. (US)
(74) Momsen, Leonardos & Cia.
referente a 9ª,10ª,11ª,12ª,13ª, 14ª e 15ª anuidades
(11) PI 9609887-2 B1 (45) 02/04/2002 24.3
(73) Hill-Rom, Inc. (US)
(74) Momsen, Leonardos & CIA.
referente a 9ª,10ª,11ª,12ª 12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9609889-9 B1 (45) 22/07/2003 24.3
(73) Krupp Uhde GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9609895-3 B1 (45) 05/08/2003 24.3
(73) ZF Meritor, LLC (US)
(74) Clarke Modet do Brasil Ltda.
referente a 14ª e 15ª anuidades
(11) PI 9609897-0 B1 (45) 17/09/2002 24.3
(73) Precision Valve Corporation (US) , Robert
Henry Abplanalp (US)
(74) Momsen, Leonardos & Cia.
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9609960-7 B1 (45) 21/06/2005 24.3
(73) Pfizer Research and Development Company,
N.V./S.A. (IE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 14ª e 15ª anuidade(s).
(11) PI 9609965-8 B1 (45) 31/10/2000 24.3
(73) Technological Resources Pty Limited (AU)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
Referente à 9ª, 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9609970-4 B1 (45) 08/06/2004 24.3
(73) The Procter & Gamble Company (US)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
referente a 13ª,14ª e 15ª anuidades
(11) PI 9609978-0 B1 (45) 20/08/2002 24.3
(73) Deep Oil Technology, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9609980-1 B1 (45) 22/07/2003 24.3
(73) Hill-Rom, Inc. (US)
(74) Momsen, Leonardos & Cia.
referente a 13ª, 14ª e 15ª anuidades
(11) PI 9609991-7 B1 (45) 14/05/2002 24.3
(73) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & CIA.
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9609994-1 B1 (45) 14/05/2002 24.3
(73) Unilever N.V. (NL)
(74) Momsen, Leonardos & CIA.
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14 ª e
15ª anuidades
(11) PI 9609899-6 B1 (45) 12/04/2005 24.3
(73) Mida S.R.L. (IT)
(74) Paulo C. Oliveira & Cia.
Referente 14a. e 15a. anuidade(s).
(11) PI 9609996-8 B1 (45) 30/04/2002 24.3
(73) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & CIA.
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9609900-3 B1 (45) 01/10/2002 24.3
(73) Basf Aktiengesellsschaft (DE)
(74) Momsen, Leonardos & Cia.
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9609997-6 B1 (45) 06/02/2001 24.3
(73) Burch Company (US)
(74) Momsen, Leonardos & CIA.
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9609901-1 B1 (45) 23/07/2002 24.3
(73) Hill-Rom, Inc. (US)
(74) Momsen, Leonardos & Cia.
referente a 9ª,10ª,11ª,12ª 12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9610006-0 B1 (45) 19/03/2002 24.3
(73) Minnesota Mining and Manufacturing Company
(US)
(74) Momsen, Leonardos & CIA.
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9609906-2 B1 (45) 11/06/2002 24.3
(73) Minnesota Mining And Manufacturing Company
(US)
(74) Momsen, Leonardos & CIA.
referente a 7ª,8ª, 9ª,10ª,11ª,12ª 12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9609909-7 B1 (45) 27/05/2003 24.3
(73) Colgate-Palmolive Company (US)
(74) Momsen, Leonardos & Cia.
referente a 8ª,9ª.10ª,11ª12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9609922-4 B1 (45) 20/08/2002 24.3
(73) Compagnie Europeenne de Dezingage (FR)
(74) Momsen, Leonardos & Cia.
Referente 14a. e 15a. anuidade(s).
(11) PI 9609928-3 B1 (45) 26/11/2002 24.3
(73) Wan-Ki Hong (KR)
(74) Tinoco Soares & Filho S/C Ltda.
referente a 13ª, 14ª e 15ª anuidades
(11) PI 9609948-8 B1 (45) 20/08/2002 24.3
(73) TVI Europe Limited (GB)
(74) Momsen, Leonardos & Cia.
referente a 8ª, 9ª,10ª,11ª,12ª 12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9609955-0 B1 (45) 06/07/2004 24.3
(73) Cryovac, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 14ª e 15ª anuidades
(11) PI 9610009-5 B1 (45) 28/05/2002 24.3
(73) JohnsonDiversey, Inc. (US)
(74) Momsen, Leonardos & CIA.
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª a
nuidades.
(11) PI 9610017-6 B1 (45) 21/08/2001 24.3
(73) Mattel, INC. (US)
(74) Momsen, Leonardos & CIA.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610018-4 B1 (45) 30/04/2002 24.3
(73) Technip Geoproduction (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 15ª anui dade.
(11) PI 9610032-0 B1 (45) 16/04/2002 24.3
(73) Emitec Gesellschaft Fuer Emissionstechnologie
Mbh (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 14ª anuidade(s).
(11) PI 9610035-4 B1 (45) 28/05/2002 24.3
(73) Vallourec Composants Automobiles Vitry (FR)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 14ª e 15ª anuidades
(11) PI 9610043-5 B1 (45) 14/05/2002 24.3
(73) Diversey IP International BV (NL)
(74) Momsen, Leonardos & CIA.
140
DIRPA - Despachos Relativos a Pedidos e Patentes
referente á 14ª e 15ª anuidades.
(11) PI 9610046-0 B1 (45) 28/05/2002 24.3
(73) Knorr-Bremse Systeme Fuer Nutzfahrzeuge
GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 11ª , 12ª , 13ª , 14ª e 15ª anui dades.
(11) PI 9610055-9 B1 (45) 03/09/2002 24.3
(73) SNR Roulements (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9610056-7 B1 (45) 22/07/2003 24.3
(73) Dispensing Containers Corporation (US)
(74) Waldemar do Nascimento
referente á 9ª , 10ª , 11ª ,12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9610063-0 B1 (45) 21/06/2005 24.3
(73) Raychem Limited (GB)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610064-8 B1 (45) 10/06/2003 24.3
(73) Scott System, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610076-1 B1 (45) 14/10/2003 24.3
(73) Michelin Recherche ET Technique S.A. (CH)
(74) Momsen, Leonardos & Cia.
Referente à 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610091-5 B1 (45) 22/07/2003 24.3
(73) Filterwerk Mann & Hummel GMBH (DE)
(74) Paulo Sérgio Scatamburlo
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9610097-4 B1 (45) 14/05/2002 24.3
(73) Sidmar N. V. (BE)
(74) Paulo Sérgio Scatamburlo
Referente 7a., 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9610100-8 B1 (45) 03/09/2002 24.3
(73) Shell Internationale Research Maatschappij
B.V. (NL)
(74) Momsen, Leonardos & Cia.
Referente à 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610111-3 B1 (45) 21/06/2005 24.3
(73) E.I. du Pont de Nemours and Company (US)
(74) Ana Paula Santos Celidonio
Referente 13a., 14a. e 15a. anuidade(s).
(11) PI 9610130-0 B1 (45) 20/08/2002 24.3
(73) Computer Associates Think, INC (US)
(74) Montaury Pimenta, Machado & Lioce S/C Ltda.
referente á 14ª e 15ª anuidades.
(11) PI 9610141-5 B1 (45) 30/03/2004 24.3
(73) Bayer CropScience AG (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9610145-8 B1 (45) 16/09/2003 24.3
(73) Colgate-Palmolive Company (US)
(74) Momsen, Leonardos & Cia.
Referente 10a., anuidade(s).
(11) PI 9610170-9 B1 (45) 05/08/2003 24.3
(73) Thermo Black Clawson Inc. (US)
(74) Momsen, Leonardos & Cia.
Referente 11a., 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9610171-7 B1 (45) 07/01/2003 24.3
(73) Exxon Chemical Patents Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9610174-1 B1 (45) 03/09/2002 24.3
(73) Ericsson Inc. (US)
RPI 2109 de 07/06/2011
(74) Momsen, Leonardos & Cia.
referente a 11ª,12ª,13ª, 14ª e 15ª anuidades
Referente a 8ª,9ª,10ª,11,ª12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9610181-4 B1 (45) 20/03/2001 24.3
(73) Steel Wheels Limited (GB)
(74) Momsen, Leonardos & CIA.
referente á 7ª , 8ª ,9ª , 10ª , 11ª , 12ª , 13ª , 14ª e
15ª anuidades.
(11) PI 9610253-5 B1 (45) 22/07/2003 24.3
(73) Weavexx Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 11ª , 12ª , 13ª , 14ª e 15ª anui dades.
(11) PI 9610189-0 B1 (45) 11/06/2002 24.3
(73) Global Upholstery Company (CA)
(74) Momsen, Leonardos & CIA.
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª ,
anuidades.
(11) PI 9610254-3 B1 (45) 13/04/2004 24.3
(73) Aeroquip Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 14ª e 15ª anuidades.
(11) PI 9610191-1 B1 (45) 24/06/2003 24.3
(73) Unilever N.V. (NL)
(74) Momsen, Leonardos & Cia.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610255-1 B1 (45) 17/02/2004 24.3
(73) Osi Specialties, Inc. (US)
(74) Daniel & Cia.
Referente a 11,ª12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610204-7 B1 (45) 04/02/2003 24.3
(73) Radkowsky Thorium Power Corporation (US)
(74) Paulo Sérgio Scatamburlo
referente á 9ª , 10ª ,11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9610256-0 B1 (45) 22/07/2003 24.3
(73) The Procter & Gamble Company (US)
(74) Vieira de Mello, Werneck Alves - Advogados
S/C
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610210-1 B1 (45) 09/07/2002 24.3
(73) Basf Aktiengesellschaft (DE)
(74) Momsen, Leonardos & Cia.
Referente a 7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9610257-8 B1 (45) 16/10/2001 24.3
(73) Siemens Automotive Corporation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9610216-0 B1 (45) 22/07/2003 24.3
(73) Xuesheng Zhao (CN)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9610217-9 B1 (45) 28/05/2002 24.3
(73) Ernst Keller (CH)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610221-7 B1 (45) 07/08/2001 24.3
(73) Uwe Nutto (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 7ª,8ª,9ª,10ª, 11ª,12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9610270-5 B1 (45) 26/11/2002 24.3
(73) Starguide Digital Networks, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 9ª,10ª,11ª12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610273-0 B1 (45) 11/04/2006 24.3
(73) Libbey-Owens-Ford Co. (US)
(74) Walter de Almeida Martins
Referente à 14ª anuidade(s).
(11) PI 9610279-9 B1 (45) 09/12/2003 24.3
(73) Continental Pet Technologies, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9610228-4 B1 (45) 02/01/2007 24.3
(73) S.C. Johnson & Son INC. (US)
(74) Nellie Anne Daniel Shoes
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610292-6 B1 (45) 28/05/2002 24.3
(73) TVI Europe Limited (GB)
(74) Momsen, Leonardos & CIA.
referente a 8ª,9ª,10ª ,11ª,12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9610231-4 B1 (45) 23/07/2002 24.3
(73) Nokia Telecommunications OY (FI)
(74) Araripe & Associados
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9610295-0 B1 (45) 14/05/2002 24.3
(73) Zeneca Limited (GB)
(74) Momsen, Leonardos & CIA.
Referente a 7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9610233-0 B1 (45) 26/06/2001 24.3
(73) Minnesota Mining And Manufacturing Company
(US)
(74) Momsen, Leonardos & CIA.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610299-3 B1 (45) 18/03/2003 24.3
(73) NPK Industrial Design B.V. (NL)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 14ª e 15ª ,, anuidades.
(11) PI 9610237-3 B1 (45) 26/11/2002 24.3
(73) Dataprint R. Kaufmann KG (GMBH & CO.) (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 9ª , 10ª , 11ª , 12ª e 13ª e 15ª
anuidades.
(11) PI 9610300-0 B1 (45) 22/01/2002 24.3
(73) Sandvik AB (SE)
(74) Thomaz Thedim Lobo
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14 ª e
15ª anuidades
(11) PI 9610238-1 B1 (45) 04/09/2001 24.3
(73) Knorr-Bremse Systeme Fuer Nutzfahrzeuge
GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610245-4 B1 (45) 25/11/2003 24.3
(73) International Fluid Separation Pty. LTD. (AU)
(74) Veirano e Advogados Associados
Referente 9a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9610247-0 B1 (45) 13/05/2003 24.3
(73) Edward A. Andrews (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(11) PI 9610301-9 B1 (45) 27/09/2005 24.3
(73) Rosemount Inc. (US)
(74) Momsen, Leonardos & Cia.
Referente 12a., 13a., 14a. e 15a. anuidade(s).
(11) PI 9610302-7 B1 (45) 19/02/2002 24.3
(73) Phillips Petroleum Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 9ª, 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610304-3 B1 (45) 05/08/2003 24.3
(73) The Procter & Gamble Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610309-4 B1 (45) 03/09/2002 24.3
RPI 2109 de 07/06/2011
(73) Antonov Automotive Technologies B.V. (NL)
(74) Tavares & Companhia
Referente a 10ª,11ª12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610310-8 B1 (45) 30/09/2003 24.3
(73) Henkel Kommanditgesellschaft Auf Aktien (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 12ª , 13ª , 14ª e 15ª anuidades.
(11) PI 9610321-3 B1 (45) 15/08/2006 24.3
(73) Jefferson Jacob Katims (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 14ª e 15ª anuidade(s).
(11) PI 9610323-0 B1 (45) 30/09/2003 24.3
(73) Purdue Research Foundation (US) , University
of North Carolina At Chapel Hill (US)
(74) Daniel & Cia.
Referente a 9ª,10ª,11ª12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610328-0 B1 (45) 17/10/2000 24.3
(73) The Whitaker Corporation (US) , Lisa
Draxlmaier GMBH (DE)
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª a
nuidades.
DIRPA - Despachos Relativos a Pedidos e Patentes 141
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9610419-8 B1 (45) 26/11/2002 24.3
(73) Dow Global Technologies Inc. (US)
(74) Paulo Sergio Scatamburlo
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª ,
anuidades.
(11) PI 9610427-9 B1 (45) 13/05/2003 24.3
(73) New Transducers Limited (GB)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9610431-7 B1 (45) 08/07/2003 24.3
(73) Ettlinger Kunststoffmaschinen GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 10ª , 11ª , 12ª , 13ª , 14ª e 15ª ,
anuidades.
(11) PI 9610432-5 B1 (45) 23/07/2002 24.3
(73) Tikkurila CPS OY (FI)
(74) Momsen, Leonardos & Cia.
referente a 11ª,12ª,13ª,14ª e 15ª anuidades
(73) Sprint Communications Company, L.P. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 9ª,10ª,11ª,12ª,13ª e 14ª anuidades
(11) PI 9610533-0 B1 (45) 07/01/2003 24.3
(73) Avonni AB (SE)
(74) Momsen, Leonardos & Cia.
referente á 14ª e 15ª anuidades.
(11) PI 9610548-8 B1 (45) 11/04/2006 24.3
(73) The Procter & Gamble Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610564-0 B1 (45) 17/08/2004 24.3
(73) The Procter & Gamble Company (US)
(74) Trench, Rossi e Watanabe
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610568-2 B1 (45) 19/03/2002 24.3
(73) Telefonaktiebolaget L.M. Ericsson (SE)
(74) Momsen, Leonardos & CIA.
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610341-8 B1 (45) 15/05/2001 24.3
(73) The Goodyer Tire & Rubber Company (US)
Referente 14a. e 15a. anuidade(s).
(11) PI 9610446-5 B1 (45) 20/08/2002 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9610578-0 B1 (45) 26/11/2002 24.3
(73) Coronet-Werke GMBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610351-5 B1 (45) 05/08/2003 24.3
(73) Digital Compression Technology, L.P. (US)
(74) Custódio de Almeida & Cia.
referente a 9ª,10ª, 11ª,12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9610450-3 B1 (45) 20/08/2002 24.3
(73) New Transducers Limited (GB)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9610598-4 B1 (45) 14/10/2003 24.3
(73) Coronet-Werke GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610358-2 B1 (45) 30/04/2002 24.3
(73) Coronet-Werke GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610455-4 B1 (45) 22/06/2004 24.3
(73) Mattel, Inc. (US)
(74) Momsen, Leonardos & Cia.
Referente à 12ª e 13ª anuidade(s).
(11) PI 9610608-5 B1 (45) 15/02/2005 24.3
(73) Pfizer, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610360-4 B1 (45) 02/10/2001 24.3
(73) BBS Motorsport & Engineering GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 12ª , 13ª , 14ª e 15ª anuidades.
(11) PI 9610365-5 B1 (45) 30/09/2003 24.3
(73) Emitec Gesellschaft Fuer Emissionstechnologie
MBH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 14ª e 15ª anuidades
(11) PI 9610369-8 B1 (45) 28/05/2002 24.3
(73) Honda Giken Kogyo Kabushiki Kaisha (Honda
Motor Co. Ltd.) (JP)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9610374-4 B1 (45) 30/04/2002 24.3
(73) New Transducers Limited (GB)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 8ª,9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9610391-4 B1 (45) 28/05/2002 24.3
(73) Sprint Communications Company, L.P. (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9610397-3 B1 (45) 13/04/2004 24.3
(73) Innovative Sputtering Technology (BE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610411-2 B1 (45) 21/08/2001 24.3
(73) Rafael-Armament Development Authority LTD
(IL)
(74) Paulo Sérgio Scatamburlo
Referente a 8ª,9ª,10ª,11ª12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9610414-7 B1 (45) 13/05/2003 24.3
(73) Riverwood International Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
(11) PI 9610459-7 B1 (45) 22/07/2003 24.3
(73) Sprint Communications Company, L.P. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 9ª,10ª,11ª,12ª, 13ª e 14ª anuidades
(11) PI 9610460-0 B1 (45) 06/01/2004 24.3
(73) Raychem Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9610462-7 B1 (45) 28/05/2002 24.3
(73) University of Northern Iowa Foundation (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente á 14ª e 15ª anuidades.
(11) PI 9610463-5 B1 (45) 08/06/2004 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
Referente a 13ª,14ª e 15ª anuidade(s).
(11) PI 9610464-3 B1 (45) 01/10/2002 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9610467-8 B1 (45) 03/02/2004 24.3
(73) Bio Med Sciences, Inc. (US)
(74) Daniel & Cia.
Referente à 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610468-6 B1 (45) 05/03/2003 24.3
(73) Kyung-Soo Lee (KR)
(74) Tinoco Soares & Filho S/C Ltda.
Referente 8a., 9a., 10a., 11a., 12a., 13a., 14a. e
15a. anuidade(s).
(11) PI 9610471-6 B1 (45) 16/09/2003 24.3
(73) Kimberly-Clark Worldwide, Inc. (US)
(74) Clarke Modet do Brasil Ltda.
Referente à 9ª, 10ª, 11ª, 12ª, 13ª e 14ª anuidade(s).
(11) PI 9610472-4 B1 (45) 01/03/2006 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Nellie Anne Daniel-Shores
referente á 13ª , 14ª e 15ª anuidades.
(11) PI 9610473-2 B1 (45) 22/07/2003 24.3
(11) PI 9610609-3 B1 (45) 20/08/2002 24.3
(73) NextLevel Systems, Inc. (US)
(74) Daniel & Cia.
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610615-8 B1 (45) 10/07/2001 24.3
(73) Norbert Marocco (CA)
Referente à 14ª anuidade(s).
(11) PI 9610657-3 B1 (45) 10/06/2003 24.3
(73) Minnesota Mining and Manufacturing Company
(US)
(74) Momsen, Leonardos & Cia.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610678-6 B1 (45) 27/11/2001 24.3
(73) Kennametal INC. (US)
(74) Paulo Sérgio Scatamburlo
Referente à 7ª, 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9610696-4 B1 (45) 10/07/2001 24.3
(73) Drahtcord Saar GMBH & CO. KG (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Referente à 14ª anuidade(s).
(11) PI 9610701-4 B1 (45) 19/03/2002 24.3
(73) Drahtcord Saar Gmbh & Co. KG (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
referente a 12ª,13ª e 14ª anuidades
(11) PI 9610713-8 B1 (45) 28/09/2004 24.3
(73) Kimberly-Clark Worldwide, Inc. (US)
(74) Orlando de Souza
Referente a 11ª,12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9610724-3 B1 (45) 17/02/2004 24.3
(73) International Comfort Products Corporation
(US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente a 13ª, 14ª e 15ª anuidades
(11) PI 9610725-1 B1 (45) 21/12/2004 24.3
(73) Société de Conseils de Recherches Et
D'Applications Scientifiques S.A.S. (FR) , The
Administrators of the Tulane Educational Fund (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
142
DIRPA - Despachos Relativos a Pedidos e Patentes
referente a 11ª,12ª,13ª e 14ª anuidades
(11) PI 9610769-3 B1 (45) 14/05/2002 24.3
(73) Rhodia Chimie (FR)
(74) Momsen, Leonardos & CIA.
referente a 9ª,10ª,11ª,12ª,13ª,14ª e 15ª anuidades
(11) PI 9610811-8 B1 (45) 14/05/2002 24.3
(73) Unilever N.V. (NL)
(74) Momsen, Leonardos & CIA.
referente a 8ª,9ª,10ª,11ª,12ª,13ª, 14ª e 15ª
anuidades
(11) PI 9610826-6 B1 (45) 22/07/2003 24.3
(73) Ceca S.A. (FR)
(74) Momsen, Leonardos & Cia.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9610907-6 B1 (45) 16/04/2002 24.3
(73) Telefonaktiebolaget L M Ericsson (SE)
(74) Momsen, Leonardos & CIA.
referente a 8ª,9ª10ª, 11ª,12ª,13ª,14ª e 15ª
anuidades
(11) PI 9611060-0 B1 (45) 02/03/2004 24.3
(73) Church & Dwight Company, Inc. (US)
(74) Custódio de Almeida & Cia.
Referente 8a., 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9611068-6 B1 (45) 13/11/2001 24.3
(73) Filterwerk Mann + Hummel GmbH (DE)
(74) Paulo Sérgio Scatamburlo
Referente a 7ª,8ª,9ª,10ª,11ª,12ª,13ª,14ª e 15ª
anuidade(s).
(11) PI 9611135-6 B1 (45) 26/11/2002 24.3
(73) Norton Company (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente à 8ª, 9ª, 10ª, 11ª, 12ª, 13ª e 14ª
anuidade(s).
(11) PI 9611256-5 B1 (45) 03/01/2006 24.3
(73) Marathon Oil Company (US)
(74) Orlando de Souza
Referente à 14ª anuidade(s).
(11) PI 9611262-0 B1 (45) 27/05/2003 24.3
(73) Advanced Minerals Corporation (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
referente á 8ª , 9ª , 10ª . , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) PI 9612228-5 B1 (45) 10/06/2003 24.3
(73) Engelhard Corporation (US)
(74) Trench, Rossi e Watanabe
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14 ª e
15ª anuidades
(11) PI 9612251-0 B1 (45) 03/09/2002 24.3
(73) New System S.R.L. (IT)
(74) Waldemar do Nascimento
Referente 10a., 11a., 12a., 13a., 14a. e 15a.
anuidade(s).
(11) PI 9612254-4 B1 (45) 30/03/2004 24.3
(73) Minnesota Mining and Manufacturing Company
(US)
(74) Momsen, Leonardos & Cia.
Referente a 14ª e 15ª anuidade(s).
(11) PI 9612600-0 B1 (45) 05/03/2003 24.3
(73) Minnesota Mining And Manufacturing Company
(US)
(74) Momsen, Leonardos & Cia.
referente a 14ª e 15ª anuidades
(11) PI 9612604-3 B1 (45) 13/04/2004 24.3
(73) Minnesota Mining and Manufacturing Company
(US)
(74) Momsen, Leonardos & Cia.
Referente a 14ª e 15ª anuidade(s).
(11) PI 9612672-8 B1 (45) 28/09/2004 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
referente a 12ª,13ª, 14ª e 15ª anuidades
(11) PI 9612681-7 B1 (45) 22/06/2004 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
referente á 12ª , 13ª , 14ª e 15ª anuidades.
RPI 2109 de 07/06/2011
(11) PI 9612683-3 B1 (45) 11/06/2002 24.3
(73) Skygate International Technology NV (AN)
(74) Momsen, Leonardos & CIA.
referente a 8ª,9ª,10ª,11ª,12ª,13ª, 14ª e 15ª
anuidades
25. Anotação de Alteração de
Nome e/ou Sede e
Transferência de Pedido,
Patente e Certificado de Adição
de Invenção
(11) PI 9612684-1 B1 (45) 22/07/2003 24.3
(73) Koninklijke Emballage Industrie Van Leer B.V.
(NL)
(74) Momsen, Leonardos & Cia.
Referente a 10ª,11ª,12ª,13ª,14ª e 15ª anuidade(s).
25.1
TRANSFERÊNCIA DEFERIDA
(11) PI 9612694-9 B1 (45) 03/09/2002 24.3
(73) Prosoya Inc. (CA)
(74) Clarke Modet do Brasil Ltda.
referente á 8ª , 9ª , 10ª , 11ª , 12ª , 13ª , 14ª e 15ª
anuidades.
(11) MU 7601543-2 Y1 (22) 07/06/1996 25.1
(45) 04/12/2007
(71) Antônio Carlos da Silva Abreu (BR/MG)
(74) Carlos José dos Santos Linhares
Transferido de: Carlos Alberto Moraes Cintra
(11) PI 9612711-2 B1 (45) 16/04/2002 24.3
(73) David E. E. Carmein (US)
(74) Momsen, Leonardos & CIA.
Referente 11a., 12a., 13a., 14a. e 15a. anuidade(s).
(21) MU 8400108-9 U2 (22) 03/02/2004 25.1
(71) Polar Indústria de Plásticos Ltda. ME (BR/SC)
(74) Sandro Wunderlich
Transferido de: Hamilton Trentin Júnior
(11) PI 9612713-9 B1 (45) 15/02/2005 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
referente á 13ª , 14ª e 15ª anuidades.
(21) MU 8702129-3 U2 (22) 27/08/2007 25.1
(71) Universidade Estadual Paulista "Júlio de
Mesquita Filho" - UNESP (BR/SP)
(74) LEOPOLDO CAMPOS ZUANETI
Transferido de: Olavo Speranza de Arruda, Eduardo
Carlos Bianchi, Paulo Roberto de Aguiar e Francine
Amaral Piubeli
(11) PI 9612719-8 B1 (45) 04/02/2003 24.3
(73) E.I. Du Pont De Nemours And Company (US)
(74) Francisco Carlos Rodrigues Silva
referente a 9ª,10ª,11ª,12ª,13ª, 14ª e 15ª anuidades
(11) PI 9612721-0 B1 (45) 26/10/2004 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
Referente a 12ª,13ª,14ª e 15ª anuidade(s).
(11) PI 9612722-8 B1 (45) 17/08/2004 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
Referente à 12ª, 13ª e 14ª anuidade(s).
(11) PI 9612723-6 B1 (45) 19/08/2003 24.3
(73) The Goodyear Tire & Rubber Company (US)
(74) Daniel & Cia.
Referente à 13ª e 14ª anuidade(s).
(11) PI 9612877-1 B1 (45) 27/05/2003 24.3
(62) PI9603154-9 24/07/1996
(73) Johnson & Johnson (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Referente 13a., 14a. e 15a. anuidade(s).
24.4
RESTAURAÇÃO
(11) PI 9400934-1 B1 (45) 24/11/1998 24.4
(73) Pinhalense S/A Máquinas Agrícolas (BR/SP)
(74) Itamarati Patentes e Marcas S/C Ltda.
24.5
DESPACHO ANULADO (**)
(11) PI 9702411-2 B1 (45) 31/08/2004 24.5
(73) Antonio Cesar Rodrigues (BR/SP)
Referente ao despacho publicado na RPI 2103 de
26/04/2011.
24.7
REPUBLICAÇÃO
(11) PI 9300164-9 B1 (45) 30/05/2000 24.7
(73) Sanyo Electric Co., Ltd (JP)
(74) Luiz Roberto do Nascimento
Referente ao despacho publicado na RPI 2078 de
03/11/2010. Texto correto: Referente a 13ª, 14ª, 15ª,
16ª, 17ª e 18ª anuidades.
(21) PI 0407455-6 A2 (22) 10/02/2004 25.1
(71) Albemarle Netherlands B.V. (NL)
(74) Dannemann , Siemsen, Bigler & Ipanema
Moreira
Transferido de: Akzo Nobel N.V.
(21) PI 0501124-8 A2 (22) 30/03/2005 25.1
(71) David Mariotti (BR/SP) , Sandro Caetano
Cardelíquio (BR/SP)
(74) Sergio Ribeiro da Silva
Transferido de: David Mariotti Revistaria - ME
(21) PI 0605651-2 A2 (22) 09/11/2006 25.1
(71) Fibria Celulose S.A. (BR/SP)
(74) Dannemann , Siemsen, Bigler & Ipanema
Moreira
Transferido por Incorporação de: Aracruz Celulose
S.A.
(21) PI 0612601-4 A2 (22) 23/06/2006 25.1
(71) Severstal Sparrows Point Holding LLC (US)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Transferido de: ISG Technology Inc.
(21) PI 0612979-0 A2 (22) 15/05/2006 25.1
(71) Continental Automotive GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Transferido por Incorporação de: VDO Automotive
AG
(21) PI 0709780-8 A2 (22) 02/04/2007 25.1
(71) Limo-Reid, Inc. (US)
(74) Paulo Maurício Carlos de Oliveira
Transferido por Incorporação de: Hybra-Drive
Systems, LLC
(11) PI 9001920-2 B1 (22) 20/04/1990 25.1
(45) 30/09/1997
(73) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9003898-3 B1 (22) 01/08/1990 25.1
(45) 25/08/1998
(73) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9102888-4 B1 (22) 02/07/1991 25.1
(45) 28/12/1999
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9105005-7 B1 (22) 11/11/1991 25.1
(45) 03/10/2000
(71) Pirelli & C. S.p.A. (IT)
RPI 2109 de 07/06/2011
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9105215-7 B1 (22) 28/11/1991 25.1
(45) 29/06/1999
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9204308-9 B1 (22) 30/10/1992 25.1
(45) 11/07/2000
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9301057-5 B1 (22) 07/05/1993 25.1
(45) 30/05/2000
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9402216-0 B1 (22) 29/06/1994 25.1
(45) 22/11/2005
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9501361-0 B1 (22) 12/04/1995 25.1
(45) 08/08/2000
(71) Pirelli & C. S.p.A. (IT)
(74) Momsen, Leonardos & CIA.
Transferido por Incorporação de: Pirelli S.p.A.
(11) PI 9508091-0 B1 (22) 19/06/1995 25.1
(45) 22/06/2004
(71) Swisscom Fixnet AG (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Transferido por Incorporação de: Swisscom Mobile
AG
DIRPA - Despachos Relativos a Pedidos e Patentes 143
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Transferido de: International Mineral Technology AG
(11) PI 9911909-9 B1 (22) 07/07/1999 25.1
(45) 25/02/2009
(71) Novozymes A/S (DK) , Imasco Limited (CA)
(74) Momsen, Leonardos & Cia.
Transferido por Incorporação de: Imperial Tobacco
Ltd.
(11) PI 9914069-1 B1 (22) 17/09/1999 25.1
(45) 04/11/2008
(71) Pirelli S.p.A. (IT)
(74) Momsen, Leonardos & Cia.
Transferido por Incorporação de: Pirelli Cavi e
Sistemi S.p.A.
(11) PI 9915116-2 B1 (22) 28/10/1999 25.1
(45) 15/08/2006
(71) The Laitram Corporation (US) , Illinois Tool
Works Inc. (US)
(74) Orlando de Souza
Transferido de: Hartness International, Inc.
(21) PI 0001765-5 A2 (22) 10/05/2000 25.1
(71) Sérgio Whyte Gailey (BR/SP)
(74) Britânia Marcas e Patentes Ltda.
Transferido de: Digicall Eletrônica e
Telecomunicações Ltda.
(11) PI 0009850-7 B1 (22) 14/04/2000 25.1
(45) 04/12/2007
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 0010441-8 B1 (22) 09/05/2000 25.1
(45) 21/10/2008
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 9509616-7 B1 (22) 03/11/1995 25.1
(45) 16/09/2003
(71) ISG Sparrows Point LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Transferido por Fusão de: Severstal Sparrows Point
Holding LLC
(11) PI 0012762-0 B1 (22) 24/07/2000 25.1
(45) 14/07/2009
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 9704201-3 B1 (22) 31/07/1997 25.1
(45) 08/06/2004
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(21) PI 0017216-2 A2 (22) 27/12/2000 25.1
(71) Oerlikon Trading AG, Trübbach (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Transferido de: OC Oerlikon Balzers AG
(11) PI 9704202-1 B1 (22) 31/07/1997 25.1
(45) 25/02/2009
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(21) PI 0103388-3 A2 (22) 29/06/2001 25.1
(71) Sérgio Whyte Gailey (BR/SP)
(74) Britânia Marcas e Patentes S/C Ltda
Transferido de: Digicall Eletrônica e
Telecomunicações Ltda.
(11) PI 9706055-0 B1 (22) 28/11/1997 25.1
(45) 18/11/2008
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(21) PI 0113435-3 A2 (22) 22/08/2001 25.1
(71) GFE Patent A/S (DK)
(74) Momsen, Leonardos & Cia.
Transferido de: Green Farm Energy A/S
(11) PI 9810782-8 B1 (22) 10/07/1998 25.1
(45) 22/04/2008
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 9810913-8 B1 (22) 09/07/1998 25.1
(45) 02/12/2008
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 9811232-5 B1 (22) 19/08/1998 25.1
(45) 14/07/2009
(71) Prysmian Cavi e Sistemi Energia S.r.l. (IT)
(74) Momsen, Leonardos & Cia.
Transferido de: Pirelli & C. S.p.A.
(11) PI 9911553-0 B1 (22) 22/06/1999 25.1
(45) 22/04/2008
(71) Pirelli S.p.A. (IT)
(74) Momsen, Leonardos & Cia.
Transferido por Incorporação de: Pirelli Cavi e
Sistemi S.p.A.
(11) PI 9911649-9 B1 (22) 29/06/1999 25.1
(45) 23/10/2007
(71) Holcim Technology Ltd. (CH)
(21) PI 0209531-9 A2 (22) 03/05/2002 25.1
(71) Albemarle Netherlands B.V. (NL)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Transferido de: Akzo Nobel N.V.
25.3
TRANSFERÊNCIA EM
EXIGÊNCIA
(21) PI 0317601-0 A2 (22) 19/12/2003 25.3
(71) Syngenta Participations AG (CH)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Afim de atender a Transferência requerida através
da Petição nº 020100074164/RJ de 11/08/2010, é
necessário apresentar o documento de cessão com
a legalização consular, bem como a guia de
cumprimento de exigência.
(21) PI 0408448-9 A2 (22) 17/03/2004 25.3
(71) Alcan International Limited (CA)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Afim de atender a Transferência requerida através
da Petição nº 018100049262/SP de 23/12/2010, é
necessário apresentar o documento de cessão
devidamente notarizado e consularizado.
(21) PI 0502003-4 A2 (22) 01/04/2005 25.3
(71) Hercílio Celso Baumgarten (BR/SC)
(74) Alice Fausto de Oliveira Ramos
Afim de atender a Transferência requerida através
da Petição nº 017100000246/SC de 03/03/2010,
reapresente o documento de cessão com firma
reconhecida do cedente, do cessionário e das duas
testemunhas, bem como a guia de cumprimento de
exigência.
(21) PI 0600453-9 A2 (22) 27/01/2006 25.3
(71) Universidade de São Paulo - USP (BR/SP)
(74) Maria Aparecida de Souza
Afim de atender a Transferência Parcial requerida
através da Petição nº 018100027084/SP de
26/07/2010, apresente o documento de cessão
assinado e com as firmas reconhecidas do cedente,
do cessionário e das duas testemunhas, bem como
documento que comprove que o representante da
pessoa jurídica cedente, tem poderes para realizar o
ato requerido; bem como a guia de cumprimento de
exigência.
(21) PI 0605962-7 A2 (22) 30/10/2006 25.3
(71) Nanox Tecnologia S/A (BR/SP)
(74) Fabíola de Moraes Spiandorello Bueno
Afim de atender a Transferência requerida através
da Petição nº 018100026476/GO de 21/07/2010,
apresente documento de cessão assinado e com as
firmas reconhecidas do cedente, do cessionário e
das duas testemunhas; procuração em nome do
cessionário; documento que comprove que o
representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, bem como a
guia de cumprimento de exigência.
(21) PI 0902824-2 A2 (22) 21/08/2009 25.3
(71) Universidade Federal de Juiz de Fora UFJF
(BR/MG)
Afim de atender a Transferência solicitada na
Petição nº 020100030688/RJ de 09/04/2010,
apresente documento que comprove que o
representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, alem de
procuração em nome dos interessados e a guia de
cumprimento de exigência.
(21) PI 0903373-4 A2 (22) 20/03/2009 25.3
(71) Universidade Federal de Minas Gerais (BR/MG)
Afim de atender a Transferência Parcial solicitada
na Petição nº 014100001332/MG de 26/04/2010,
apresente documentos os quais comprovem que o
representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, bem como a
guia de cumprimento de exigência.
(21) PI 0903587-7 A2 (22) 22/05/2009 25.3
(71) Universidade Federal de Minas Gerais (BR/MG)
Afim de atender a Transferência Parcial solicitada
na Petição nº 014090004557/MG de 02/10/2009,
apresente documentos os quais comprovem que o
representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, bem como a
guia de cumprimento de exigência.
(21) PI 0903866-3 A2 (22) 03/04/2009 25.3
(71) Universidade Estadual de Campinas - Unicamp
(BR/SP)
(74) Maria Cristina Valim Lourenço Gomes
Afim de atender a Transferência Parcial solicitada
na Petição nº 018090055004/SP de 11/12/2009,
reapresente o documento de cessão com as
assinaturas e reconhecimentos de firma do cedente,
do cessionário e das duas testemunhas, bem como
documentos que comprovem que o representante
da pessoa jurídica cedente, tem poderes para
realizar o ato requerido, bem como a guia de
cumprimento de exigência.
(21) PI 0904015-3 A2 (22) 02/10/2009 25.3
(71) Universidade Federal de Juiz de Fora (BR/MG)
Afim de atender a Transferência solicitada na
Petição nº 020100030687/RJ de 09/04/2010,
apresente documento que comprove que o
representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, alem de
procuração em nome dos interessados e a guia de
cumprimento de exigência.
(21) PI 0008450-6 A2 (22) 16/03/2000 25.3
(71) Nokia Mobile Phones Limited (FI)
(74) Araripe & Associados
144
DIRPA - Despachos Relativos a Pedidos e Patentes
Afim de atender as Transferências solicitadas na
Petição nº 020100075687/RJ de 16/08/2010, é
necessário apresentar procuração em nome do
interessado, bem como a guia de cumprimento de
exigência.
(21) PI 0104785-0 A2 (22) 07/08/2001 25.3
(71) Conselho Nacional de Desenvolvimento
Cinentífico e Tecnológico CNPq (BR/DF)
(74) Eury Pereira Luna Filho
Afim de atender a Transferência requerida através
da Petição nº 026100000319/GO de 27/05/2010,
apresente o documento de cessão com as firmas
reconhecidas do cedente, do cessionário e das duas
testemunhas, além de documento que comprove
que o representante da pessoa jurídica cedente, tem
poderes para realizar o ato requerido, bem como a
guia de cumprimento de exigência.
25.4
ALTERAÇÃO DE NOME
DEFERIDA
(11) MU 7800486-1 Y1 (22) 15/04/1998 25.4
(45) 11/11/2003
(71) Boxtop do Brasil Elevadores Ltda. EPP (BR/SC)
(74) Cerumar & Marcas Patentes
Nome Alterado de: Boxtop do Brasil Elevadores
Automotivos Ltda. EPP
(21) PI 0615640-1 A2 (22) 11/09/2006 25.4
(71) FiReP Rebar Technology GmbH (DE)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Beltec Industrietechnik GmbH
(11) PI 9400239-8 B1 (22) 28/01/1994 25.4
(45) 25/07/2000
(71) Whirlpool S.A. (BR/SP)
(74) Carina Souza Rodrigues
Nome Alterado de: Multibrás S/A Eletrodomésticos
(11) PI 9709145-6 B1 (22) 01/05/1997 25.4
(45) 13/01/2009
(71) Tyco Electronics Raychem N.V. (BE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: N.V. Raychem S.A.
(11) PI 9815047-2 B1 (22) 18/11/1998 25.4
(45) 07/04/2009
(71) Schill + Seilacher "Struktol" Aktiengesellschaft
(DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Schill & Seilacher (GmbH & Co.)
(11) PI 9907053-7 B1 (22) 25/10/1999 25.4
(45) 19/06/2007
(71) Carefusion 203, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Cardinal Health 203, Inc.
(11) PI 9909844-0 B1 (22) 20/04/1999 25.4
(45) 19/10/2010
(71) Merck Sharp & Dohme Corp. (US)
(74) Momsen, Leonardos & CIA.
Nome Alterado de: Merck & Co., Inc.
(11) PI 9911077-6 B1 (22) 28/05/1999 25.4
(45) 28/07/2009
(71) Evonik Stockhausen GmbH (DE)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Stockhausen GmbH
(21) PI 9914499-9 A2 (22) 23/09/1999 25.4
(71) Cernofina, LLC (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Cerno BioSciences, LLC
(11) PI 9915253-3 B1 (22) 03/11/1999 25.4
(45) 18/12/2007
(71) Elliott Company I (US)
(74) Martinez & Moura Barreto S/C Ltda.
Nome Alterado de: Elliott Turbomachinery Company,
Inc.
(21) PI 0215689-0 A2 (22) 10/04/2002 25.4
(71) Sang Bong Lee (KR) , Yong Jin Yang (KR) ,
Komipharm International Co., Ltd. (KR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Nome Alterado de: Korea Microbiological
Laboratories, Ltd.
25.6
ALTERAÇÃO DE NOME EM
EXIGÊNCIA
(21) PI 0603699-6 A2 (22) 18/08/2006 25.6
(71) Arena P.C.M. S/C Ltda - ME (BR/SP)
(74) Icamp Marcas e Patentes Ltda
Afim de atender as Alterações de Nome e Sede
requeridas através da Petição nº 018100041867/SP
de 08/11/2010, é necessário apresentar mais uma
guia para alteração de nome e mais tres guias para
as alterações de sede solicitadas, além da guia
cumprimento de exigência.
(21) PI 0603796-8 A2 (22) 14/09/2006 25.6
(71) Sanfergraf Indústria Gráfica Ltda (BR/SP)
(74) Rosana Silveira da Silva
Afim de atender a Alteração de Nome requerida
através da Petição nº 020100051973/RJ de
10/06/2010, é necessário complementar o valor da
guia, uma vez que o interessado não faz jus a taxa
reduzida, bem como apresentar a guia de
cumprimento de exigência.
(21) PI 0606134-6 A2 (22) 30/01/2006 25.6
(71) Pliant Corporation (US)
(74) GUERRA ADV.
Afim de atender a Alteração de Nome, requerida
através da Petição nº 016100006370/RS de
11/11/2010, é necessário apresentar o documento
com a legalização consular.
(21) PI 0608065-0 A2 (22) 09/08/2006 25.6
(71) Huntsman Petrochemical Corporation (US)
(74) Octávio Tinoco Soares
Afim de atender a Alteração de Nome, requerida
através da Petição nº 018100036696/SP de
30/09/2010, é necessário apresentar o documento
com a legalização consular.
(21) PI 0702270-0 A2 (22) 03/05/2007 25.6
(71) Faster International S.r.l. (IT)
(74) Dannemann ,Siemsen, Bigler & Ipanema
Moreira
Afim de atender a Alteração de Nome, requerida
através da Petição nº 020100070116/RJ de
30/07/2010, é necessário recolher a guia referente
ao ato requerido.
25.7
ALTERAÇÃO DE SEDE
DEFERIDA
(21) PI 0615515-4 A2 (22) 14/07/2006 25.7
(71) Hans-Armin Ohlmann (CA)
(74) David do Nascimento Advogados Associados
Endereço alterado conforme solicitado na Petição nº
018090018544/SP de 13/04/2009.
(21) PI 0615588-0 A2 (22) 31/08/2006 25.7
(71) Serentis Limited (GB)
(74) Montaury Pimenta, Machado & Lioce
Endereço alterado conforme solicitado na Petição nº
020080112772/RJ de 22/08/2008.
(11) PI 9906410-3 B1 (22) 07/05/1999 25.7
(45) 28/08/2007
(71) Geoservices Equipements (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Endereço alterado conforme solicitado na Petição nº
020100044624/RJ de 19/05/2010.
(11) PI 9907053-7 B1 (22) 25/10/1999 25.7
(45) 19/06/2007
(71) Carefusion 203, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Endereço alterado conforme solicitado na Petição nº
020100083449/RJ de 08/09/2010.
(11) PI 9913268-0 B1 (22) 27/08/1999 25.7
(45) 05/10/2010
RPI 2109 de 07/06/2011
(71) Fraunhofer-Gesellschaft zur Förderung der
angewandten Forschung e.V. (DE)
(74) Custódio de Almeida & Cia.
Endereço alterado conforme solicitado na Petição nº
020100040327/RJ de 07/05/2010.
(21) PI 0206049-3 A2 (22) 23/09/2002 25.7
(71) Geoservices Equipements (FR)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Endereço alterado conforme solicitado na Petição nº
020100044617/RJ de 19/05/2010.
(21) PI 0206996-2 A2 (22) 01/02/2002 25.7
(71) CareFusion 303, Inc. (US)
(74) Dannemann, Siemsen, Bigler & Ipanema
Moreira
Endereço alterado conforme solicitado na Petição nº
020100048647/RJ de 31/05/2010.
25.13
ANOTAÇÃO DE LIMITAÇÃO OU
ÔNUS
(21) PI 0805338-3 A2 (22) 19/12/2008 25.13
(71) GM Global Technology Operations, Inc. (US)
(72) Joseph M. Lendway, IV, Alexander D.
Khakhalev, Don Reams
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004489/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(11) PI 9601368-0 B1 (22) 15/04/1996 25.13
(45) 20/08/2002
(71) GM Global Technology Operations, Inc.
(Delaware) (US)
(72) Manfred Schneider, Hans Thul
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004541/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(11) PI 9602078-4 B1 (22) 26/04/1996 25.13
(45) 19/03/2002
(71) GM Global Technology Operations, Inc. (US)
(72) June-Sang Siak, William Thomas Whited, Mark
Allen Datte, Richard Michael Schreck
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004543/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(11) PI 9606042-5 B1 (22) 17/12/1996 25.13
(45) 17/10/2000
(71) GM Global Technology Operations, Inc. (US)
(72) June-Sang Siak, William Thomas Whited, Scott
William Biederman, Mark Allen Datte
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004526/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(21) PI 0200515-8 A2 (22) 22/02/2002 25.13
(71) GM Global Technology Operations, Inc.
(Delaware) (US)
(72) Michael Huber
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004501/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(21) PI 0200529-8 A2 (22) 26/02/2002 25.13
(71) GM Global Technology Operations, Inc.
(Delaware) (US)
(72) Thomas Wanke, Stefan Glober
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
RPI 2109 de 07/06/2011
requerido na Petição nº 018100004499/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
(21) PI 0204558-3 A2 (22) 30/10/2002 25.13
(71) GM Global Technology Operations, Inc. (US)
DIRPA - Despachos Relativos a Pedidos e Patentes 145
(72) Scott A. McCullough
(74) Paulo Sérgio Scatamburlo
Liberado o Gravame - Contrato de Garantia de
Propriedade Intelectual celebrado entre: o Titular e
United States Department of the Treasury, conforme
requerido na Petição nº 018100004514/SP de
11/02/2010, de acordo com o Art. 59, II da LPI.
Diretoria de Contratos, Indicações Geográficas e
Registros - DICIG
Tabela de Códigos de Despachos de Pedidos e
Registros de Desenhos Industriais
RPI 2109 de 07/06/2011
30
31
Exigência – Art. 103 da LPI
O pedido requerido pela petição citada não
atende formalmente ao disposto no art. 103 da
LPI e/ou às demais disposições quanto à sua
forma, tendo sido recebido provisoriamente.
Não tendo sido possível uma ciência ao
interessado diretamente no processo ou por via
postal, fica o requerente obrigado a sanar, em
5 (cinco) dias a contar desta data, as
exigências estabelecidas. Não sendo a
exigência cumprida com a apresentação da
documentação correspondente no prazo acima,
o depósito não será aceito e a documentação
ficará à disposição do interessado.
Banco
de
Patentes
do
Centro
de
Documentação e Informação Tecnológica do
INPI - CEDIN - o folheto com o relatório
descritivo e reivindicações (se for o caso) e
desenhos do pedido.
35.1
Arquivamento da Petição
Arquivada a petição. Desta data corre o prazo
de 60 (sessenta dias) para eventual recurso do
interessado.
42
Extinção - Art. 119 inciso I da LPI
Notificação da extinção do registro de desenho
industrial, pela expiração do prazo de vigência
de proteção legal ou da prorrogação.
36
Indeferimento - Art. 106 § 4º da LPI
Indeferido o pedido por não atender ao
disposto no Art. 100 da LPI, conforme parecer
técnico. A cópia do parecer técnico poderá ser
solicitada através do formulário Modelo 2.04.
Desta data corre o prazo de 60 (sessenta) dias
para eventual recurso do depositante. Pode ser
adquirido no Banco de Patentes do Centro de
Documentação e Informação Tecnológica do
INPI - CEDIN - o folheto com o relatório
descritivo e reivindicações (se for o caso) e
desenhos do pedido.
43
Extinção - Art. 119 inciso II da LPI
Notificação da extinção do registro de desenho
industrial, pela homologação da renúncia
apresentada pelo seu titular. Homologada a
renúncia, o registro será considerado extinto na
data da apresentação da renúncia.
44
Extinção - Art. 119 inciso III da LPI
Notificação da extinção do registro de desenho
industrial pela falta de pagamento da
retribuição prevista nos Arts. 108 e 120 da LPI.
45
Extinção - Art. 119 inciso IV da LPI
Notificação da extinção do registro de desenho
industrial uma vez que após solicitação do INPI
o titular deixou de comprovar a obrigação
decorrente do Art. 217 da LPI.
46
Prorrogação
Prorrogada a vigência do certificado do
registro de desenho industrial por solicitação do
titular.
46.1
Exigência de comprovação de qüinqüênio
e/ou prorrogação – Arts. 120 e 108 da LPI
O Titular deverá apresentar a comprovação do
pagamento
de
qüinqüênio/prorrogação
recolhido dentro do prazo legal estabelecido.
Não cumprida a exigência no prazo de 60
(sessenta)
dias,
presumir-se-á o não
pagamento, acarretando a extinção do registro.
46.2
Exigência
de
complementação
de
qüinqüênio e/ou prorrogação – Art. 120 e
108 da LPI
O Titular deverá complementar, de acordo com
a tabela vigente na data da complementação o
recolhimento
do
qüinqüênio/prorrogação
especificado através do formulário modelo
1.07, acompanhado da guia de "cumprimento
de exigência" e da de “complementação”. O
não cumprimento no prazo de 60 (sessenta)
dias acarretará a extinção do registro.
46.3
Qüinqüênio/Prorrogação em exigência – Art.
120 e 108 da LPI.
Exigência referente ao pagamento de
qüinqüênio e/ou prorrogação. Desta data corre
o prazo de 60 (sessenta) dias para
cumprimento da exigência formulada sob pena
de extinção do registro ou desconsideração do
pagamento.
47
Petição Não Conhecida
Não conhecimento da petição apresentada em
virtude do disposto nos Arts. 218 ou 219 da
LPI.
Notificação de Depósito
Notificação de depósito de pedido de
registro de desenho industrial. O
pedido estará disponível para vista ou
cópias a serem requisitadas na
DIRTEC/CGREG/SEATOR.
32
Notificação do Depósito Com Requerimento
de Sigilo
Tendo sido requerido o sigilo na forma do Art.
106 § 1º o processamento do pedido será
suspenso pelo prazo de 180 (cento e oitenta)
dias . O depositante poderá solicitar a retirada
do pedido dentro do prazo de 90 (noventa) dias
contados da data do depósito. A retirada do
pedido sem que o mesmo tenha produzido
qualquer efeito dará prioridade ao depósito
imediatamente posterior.
33
Pedido Retirado
Retirado o pedido com base no Art. 105 da LPI
a requerimento do depositante.
34
Exigência - Art. 106 § 3º da LPI
Suspensão do andamento do pedido de
registro de desenho industrial que, para
instrução regular, aguardará o atendimento ou
contestação das exigências formuladas. Caso a
exigência não tenha sido explicitada no
despacho da RPI, o depositante poderá
requerer cópia do parecer através do formulário
Modelo 1.05.
A não manifestação do
depositante no prazo de 60 (sessenta) dias
desta data acarretará o arquivamento
definitivo do pedido.
34.1
35
Conhecimento de Parecer Técnico - Art. 100
inciso II da LPI
Suspenso o andamento do Pedido para que o
depositante se manifeste no prazo de 60
(sessenta) dias desta data, quanto ao contido
no parecer técnico. A não manifestação ou a
manifestação
considerada
improcedente
acarretará o indeferimento do pedido.
Arquivamento do Pedido – Art. 216 § 2º e
Art. 106 § 3º da LPI
Arquivado definitivamente o pedido de registro
de desenho industrial, uma vez que não foi
apresentada a procuração devida no prazo de
60 (sessenta) dias contados da prática do
primeiro ato da parte no processo ou não
houve manifestação do depositante quanto à
exigência formulada. Pode ser adquirido no
contados da data da concessão, os efeitos da
concessão do Registro serão suspensos (Art.
113 § 2º). Poderá ser requerida cópia do
processo de nulidade através de formulário
específico.
37
Recurso Contra o Indeferimento
Notificação de interposição de recurso ao
Presidente do INPI contra o indeferimento do
pedido de registro de desenho industrial,
objetivando o reexame da matéria. Desta data
corre o prazo de 60 (sessenta) dias para
apresentação de contra-razões por qualquer
interessado. Poderá ser requerida cópia do
recurso através de formulário específico.
38
Outros Recursos
Notificação de interposição de recurso ao
Presidente do INPI contra a decisão proferida
pela DIRTEC, objetivando o reexame da
matéria. Desta data corre o prazo de 60
(sessenta) dias para apresentação de contrarazões por qualquer interessado. Poderá ser
requerida cópia do recurso através de
formulário específico.
39
Concessão do Registro
Expedição do certificado de registro de
desenho industrial. O título acha-se à
disposição do interessado no setor competente
do INPI. Desta data corre o prazo de 5 (cinco)
anos
para
interposição
de
nulidade
administrativa por qualquer interessado (Art.
113 § 1º da LPI ). Se interposto o pedido de
nulidade no prazo de 60 (sessenta) dias
contados da data da concessão, os efeitos da
concessão do registro serão suspensos (Art.
113 § 2º).
40
Publicação do Parecer de Mérito
Notificação da emissão do parecer de mérito
conforme previsto no Art. 111 da LPI. O
parecer estará a disposição do interessado no
setor competente do INPI.
41
Nulidade Administrativa
Notificação, ao titular do Registro, de
instauração de processo administrativo de
nulidade. Desta data corre o prazo de 60
(sessenta) dias para eventual contestação do
titular (Art. 114 da LPI). Se interposto o pedido
de nulidade no prazo de 60 (sessenta) dias
148
47.1
48
DICIG - Tabela de Códigos de Despachos de Pedidos e Registros de Desenhos Industriais
Petição Sustada
Sustado o conhecimento da petição para
aguardar providências necessárias ao seu
conhecimento.
Perda de Prioridade
Perda da prioridade reivindicada por não
atender às disposições previstas no Art. 99 da
LPI.
50
Alteração de Classificação
Alterada a classificação do registro para melhor
adequação.
51
Renumeração
Alterada a numeração por ter sido numerado
indevidamente.
52
Numeração Anulada
Anulada a numeração do registro.
53
Notificação de Decisão Judicial
Notificação de decisão judicial referente ao
registro.
53.1
Registro Sub-Judice
Notificação de Ação Judicial referente ao
registro.
54
Devolução de Prazo Concedida
Notificação de devolução de prazo. Desta data
corre o prazo adicional concedido no despacho.
O prazo será de 5 (cinco) dias, na hipótese do
Art. 103 da LPI e de, no mínimo 15 (quinze)
dias a, no máximo, o prazo legal dos atos
correspondentes nos demais casos. De acordo
com o estabelecido na Resolução 116/2004.
54.1
55
Formulada exigência para adequação ou
cumprimento de disposições legais no prazo de
60 (sessenta) dias desta data. Caso a
exigência não tenha sido explicitada no
despacho da RPI, o depositante/titular poderá
requerer cópia do parecer através de formulário
específico.
Petição Prejudicada
Prejudicada a Petição Indicada de acordo com
o complemento.
49
Devolução de Prazo Negada
Negada a solicitação de devolução de prazo
uma vez que não ficou comprovada a justa
causa conforme definido no Art. 221 da LPI e
com base na Resolução 116/2004. A cópia do
parecer poderá ser solicitada através de
formulário específico. Desta data corre o prazo
de 60 (sessenta) dias para eventual recurso do
interessado.
56
Transferência Deferida
Notificação do deferimento da transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
57
Transferência Indeferida
Notificação do indeferimento da transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
58
Transferência em Exigência
Exigência referente ao pedido de transferência
requerida. Desta data corre o prazo de 60
(sessenta) dias para cumprimento da exigência
formulada, sob pena de Arquivamento da
Petição do pedido de Transferência.
59
60
61
62
Exigências Diversas
Códigos para
Identificação de Dados
Bibliográficos
(INID)
(11)
Número do Registro
(15)
Data do Registro/Data da Prorrogação
(21)
Número do Pedido
RPI 2109 de 07/06/2011
Alteração de Nome Deferida
Notificação do deferimento da alteração de
nome requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
Alteração de Nome Indeferida
Notificação do indeferimento da alteração de
nome requerida. Desta data corre o prazo de
60 (sessenta) dias para eventual recurso do
interessado.
Alteração de Nome em Exigência
Exigência referente ao pedido de alteração
nome requerida. Desta data corre o prazo
60 (sessenta) dias para cumprimento
exigência
formulada,
sob
pena
arquivamento da Petição do pedido
alteração.
de
de
da
de
de
Alteração de Sede Deferida
Notificação do deferimento da alteração de
Sede requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
(22)
Data do Depósito
(30)
Dados da Prioridade Unionista (data, país e
número)
(43)
Data de Publicação do Desenho Industrial
(antes de ser examinado)
(44)
Data de Publicação do Desenho Industrial
(depois de examinado, mas antes da
concessão do registro)
(45)
Data de Publicação do Desenho Industrial
(após concessão)
63
Alteração de Sede Indeferida
Notificação do indeferimento da alteração de
Sede requerida. Desta data corre o prazo de 60
(sessenta) dias para eventual recurso do
interessado.
64
Alteração de Sede em Exigência
Exigência referente ao pedido de alteração de
Sede requerida. Desta data corre o prazo de 60
(sessenta) dias para cumprimento da exigência
formulada, sob pena de arquivamento da
Petição do pedido de alteração.
65
Desistência Homologada
Homologada a desistência do pedido de
registro ou da petição relativa a desenho
industrial apresentada pelo depositante, com
base no art. 51 da Lei 9.784/99. Pode ser
adquirido no Banco de Patentes do Centro de
Documentação e Informação Tecnológica do
INPI - CEDIN - o folheto com o relatório
descritivo e reivindicações (se for o caso) e
desenhos do pedido.
66
Anotação de Limitação ou Ônus
Notificação referente à anotação de limitação
ou ônus conforme indicado no complemento
70
Publicação Anulada
Anulada a publicação de qualquer um dos itens
anteriores por ter sido indevida.
71
Despacho Anulado
Anulado o despacho de qualquer um dos itens
anteriores, por ter sido indevido.
72
Decisão Anulada
Anulação da decisão referente a qualquer um
dos itens anteriores por ter sido indevida.
73
Retificação
Retificação da publicação de qualquer um dos
itens anteriores por ter sido efetuada com
incorreção. Tal publicação não implica na
alteração da data da decisão ou despacho e
nos prazos decorrentes da mesma.
74
Republicação
Republicação da publicação de qualquer um
dos itens anteriores por ter sido indevida.
(52)
Classificação Nacional
(54)
Título
(71) Nome do Depositante
(72)
Nome do Autor
(73)
Nome do Titular
(74)
Nome do Procurador
(78)
Nome do Novo Titular no caso de Mudança
de Titular
Diretoria de Contratos, Indicações Geográficas e
Registros - DICIG
Índice Numérico Remissivo de Pedidos e Registros
de Desenho Industrial
RPI 2109 de 07/06/2011
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
6102683-2
6200025-0
6200944-3
6301017-8
6301017-8
6301018-6
6301018-6
6301019-4
6301020-8
6301321-5
6301322-3
6504207-7
6600255-9
6600256-7
6601597-9
6704674-6
6705212-6
6800378-1
6800445-1
6801068-0
6801495-3
6801497-0
6801613-1
6801755-3
6801756-1
6802982-9
6803058-4
6803059-2
6803155-6
6803238-2
6803544-6
6803988-3
6803990-5
6804149-7
6804594-8
6804618-9
6804659-6
6804910-2
6805385-1
6805445-9
6805576-5
6900155-3
6900439-0
6900463-3
6900936-8
6901204-0
6901205-9
6901460-4
6902337-9
6902505-3
6902601-7
6902602-5
6902606-8
6902616-5
6902631-9
6902764-1
6903019-7
6903031-6
6903040-5
6903108-8
6903161-4
6903162-2
6903642-0
6903664-0
6903851-1
6903856-2
6903910-0
6903939-9
6904177-6
6904180-6
6904181-4
6904184-9
6904185-7
6904186-5
6904187-3
6904189-0
6904488-0
6904803-7
6904807-0
6905090-2
6905091-0
6905125-9
6905166-6
6905214-0
7000047-6
7000049-2
7000732-2
7000759-4
7000916-3
7000917-1
62
58
56
59
62
59
62
59
59
56
56
61
62
62
39
41
41
41
53
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
41
39
41
41
58
41
41
39
41
41
41
41
39
39
39
39
39
39
39
41
39
41
41
39
39
41
41
41
47
41
41
59
59
59
59
59
59
59
59
39
39
39
39
39
39
39
39
41
41
39
39
39
39
187
186
186
186
187
186
187
187
187
186
186
187
187
187
151
185
185
185
186
185
185
185
185
185
185
185
185
185
185
185
185
185
185
185
185
185
185
185
151
185
185
186
185
185
151
185
185
185
185
151
152
152
152
152
152
153
185
153
185
185
153
153
185
186
186
186
186
186
187
187
187
187
187
187
187
187
154
154
154
154
155
155
155
155
186
186
155
156
156
156
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
DI
7001098-6
7001387-0
7001568-6
7002236-4
7002423-5
7002426-0
7002427-8
7002428-6
7002538-0
7002695-5
7002696-3
7002697-1
7002698-0
7002699-8
7002999-7
7003230-0
7003262-9
7003263-7
7003264-5
7003265-3
7003266-1
7003267-0
7003268-8
7003344-7
7003907-0
7003908-9
7003909-7
7003910-0
7003911-9
7003912-7
7003913-5
7004083-4
7004084-2
7004085-0
7004086-9
7004158-0
7004424-4
7004426-0
7004427-9
7004428-7
7004853-3
7004854-1
7004855-0
7005212-3
7005313-8
7005314-6
7005368-5
7005369-3
7005373-1
7005374-0
7005375-8
7005376-6
7005378-2
7005379-0
7005387-1
7005388-0
7005512-2
7100018-6
7100049-6
7100050-0
7100051-8
7100052-6
7100053-4
7100054-2
7100055-0
7100056-9
7100057-7
7100059-3
7100061-5
7100062-3
7100063-1
7100064-0
7100067-4
7100068-2
7100069-0
7100070-4
7100071-2
7100310-0
7100349-5
7100350-9
7100351-7
7100384-3
7100393-2
7100401-7
7100403-3
7100404-1
7100405-0
41
39
41
39
39
39
39
39
39
39
39
39
39
39
41
55
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
56
56
56
56
41
41
41
39
39
39
39
39
39
39
39
39
39
39
39
39
39
55
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
39
186
157
186
157
157
160
162
165
168
168
169
169
169
169
186
186
169
170
170
170
170
171
171
171
171
171
172
172
172
172
173
173
173
173
174
174
186
186
186
186
186
186
186
174
174
174
175
175
175
175
175
176
176
176
176
176
177
186
177
177
177
177
178
178
178
178
178
179
179
179
179
180
180
180
180
180
180
181
181
181
182
182
182
182
183
183
183
Diretoria de Contratos, Indicações Geográficas e
Registros - DICIG
Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
39
CONCESSÃO DO REGISTRO
(11) DI 6601597-9 (22) 17/05/2006
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-03
(54) CONFIGURAÇÃO APLICADA À MESA
(73) JOSE MARCOS LEMOS FOCHI (BR/RJ)
(72) JOSE MARCOS LEMOS FOCHI
Prazo de validade: 10 (dez) anos contados a partir de 17/05/2006, observadas as
condições legais.
(11) DI 6900936-8 (22) 16/03/2009
39
(15) 07/06/2011
(30) 16/09/2008 US 29/324,579
(45) 07/06/2011
(52)(BR) 24-02
(54) CONFIGURAÇÃO APLICADA A UM COMPONENTE DE APARELHO
ORTODÔNTICO
(73) Maria Carolina Blanco-Acevedo (US)
(72) Maria Carolina Blanco-Acevedo
(74) Araripe & Associados
Prazo de validade: 10 (dez) anos contados a partir de 16/03/2009, observadas as
condições legais.
(11) DI 6805385-1 (22) 28/11/2008
39
(15) 07/06/2011
(30) 12/09/2008 US 29/324,477
(45) 07/06/2011
(52)(BR) 14-03
(54) CONFIGURAÇÃO APLICADA A UM APARELHO DE TELEFONIA CELULAR
(73) Nokia Corporation (FI)
(72) Travis Tom
(74) Araripe & Associados
Prazo de validade: 10 (dez) anos contados a partir de 28/11/2008, observadas as
condições legais.
(11) DI 6902505-3 (22) 10/07/2009
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-02
(54) CONFIGURAÇÃO APLICADA NA FORMA PLÁSTICA PARA MOLDAR
39
152
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(73) Jovenil Rosa Malaguez (BR/RS)
(72) Jovenil Rosa Malaguez
Prazo de validade: 10 (dez) anos contados a partir de 10/07/2009, observadas as
condições legais.
(52)(BR) 23-01
(54) CONFIGURAÇÃO APLICADA EM FILTRO
(73) Luiz Filipe de Souza Sisson (BR/RS)
(72) Luiz Filipe de Souza Sisson
(74) Vilage Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 20/07/2009, observadas as
condições legais.
(11) DI 6902601-7 (22) 20/07/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 23-03
(54) CONFIGURAÇÃO APLICADA EM QUEIMADOR
(73) Ricardo Leite Passos (BR/SP)
(72) Ricardo Leite Passos
(74) Vilage Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 20/07/2009, observadas as
condições legais.
(11) DI 6902616-5 (22) 19/06/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-02
(54) DESIGN DE PROPAGANDA EM CARRINHO DE SUPERMERCADO
(73) SD Serviços e Comercio em Educação Ltda me (BR/PE)
(72) Evandro Jose Nemesio de Barros
(74) Francisco Leite de Oliveira Filho
Prazo de validade: 10 (dez) anos contados a partir de 19/06/2009, observadas as
condições legais.
O objeto do registro não atende ao disposto no artigo 95 da LPI. Será instaurado o
processo de nulidade.
(11) DI 6902602-5 (22) 20/07/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 23-03
(54) CONFIGURAÇÃO APLICADA EM QUEIMADOR
(73) Ricardo Leite Passos (BR/SP)
(72) Ricardo Leite Passos
(74) Vilage Marcas e Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 20/07/2009, observadas as
condições legais.
(11) DI 6902631-9 (22) 18/06/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-01
(54) CONFIGURAÇÃO EM EMBALAGEM PARA HORTALIÇAS
(73) PLASTCONE INDÚSTRIA E COMÉRCIO DE EMBALAGENS LTDA (BR/SP)
(72) Antonio Domene
(74) AMADEU GENNARI FILHO
Prazo de validade: 10 (dez) anos contados a partir de 18/06/2009, observadas as
condições legais.
(11) DI 6902606-8 (22) 20/07/2009
(15) 07/06/2011
(45) 07/06/2011
39
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 153
(11) DI 6903031-6 (22) 07/08/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA EM PASTA
(73) RL Indústria e Comércio de Embalagens Ltda Me (BR/SC)
(72) Tânia Stela Berkenbrock Zimmermann
(74) Sandro Wunderlich
Prazo de validade: 10 (dez) anos contados a partir de 07/08/2009, observadas as
condições legais.
(11) DI 6903161-4 (22) 17/08/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 08-03
(54) CONFIGURAÇÃO APLICADA EM FACA
(73) André Roberto Jacob (BR/SP)
(72) André Roberto Jacob
(74) Vilage Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 17/08/2009, observadas as
condições legais.
(11) DI 6902764-1 (22) 01/07/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-05
(54) CONFIGURAÇÃO APLICADA EM EMBALAGEM PARA SAPONÁCEOS EM
BARRA
(73) Inapel Embalagens Ltda (BR/SP)
(72) Rodrigo Amado Alvarez
Prazo de validade: 10 (dez) anos contados a partir de 01/07/2009, observadas as
condições legais.
(11) DI 6903162-2 (22) 17/08/2009
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 08-03, 08-06
(54) CONFIGURAÇÃO APLICADA EM PARAFUSO
(73) André Roberto Jacob (BR/SP)
(72) André Roberto Jacob
(74) Vilage Marcas & Patentes S/S Ltda
39
154
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
Prazo de validade: 10 (dez) anos contados a partir de 17/08/2009, observadas as
condições legais.
(54) CONFIGURAÇÃO ORNAMENTAL APLICADA A COXIN PARA AR
CONDICIONADO
(73) Ricardo Rivera de Ávila Nizarala (BR/RS)
(72) Ricardo Rivera de Ávila Nizarala
(74) D'Mark Registros de Marcas e Patentes S/C Ltda
Prazo de validade: 10 (dez) anos contados a partir de 14/12/2009, observadas as
condições legais.
(11) DI 6904488-0 (22) 25/11/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-06
(54) CONFIGURAÇÃO APLICADA EM BUFFET COM PRATOS
(73) KARINA MINDEL (BR/SP)
(72) KARINA MINDEL
(74) DAVID DO NASCIMENTO ADVOGADOS ASSOCIADOS
Prazo de validade: 10 (dez) anos contados a partir de 25/11/2009, observadas as
condições legais.
(11) DI 6904807-0 (22) 10/11/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 15-02
(54) CONFIGURAÇÃO INTRODUZIDA EM GERADOR DE VÁCUO
(73) Luiz Tadeu Sel Franco (BR/SP)
(72) Luiz Tadeu Sel Franco
(74) SIGILO'S MARCAS E PATENTES S/C LTDA.
Prazo de validade: 10 (dez) anos contados a partir de 10/11/2009, observadas as
condições legais.
(11) DI 6905090-2 (22) 29/12/2009
39
(15) 07/06/2011
(30) 02/07/2009 US 29/339,571
(45) 07/06/2011
(52)(BR) 09-05
(54) CONFIGURAÇÃO APLICADA EM PEÇA DE OMBRO PARA UM RECIPIENTE
(73) Colgate-Palmolive Company (US)
(72) Peter J. Fallat II, Bruce Cummings, Brian Worthington
(74) Momsen, Leonardos & Cia
Prazo de validade: 10 (dez) anos contados a partir de 29/12/2009, observadas as
condições legais.
(11) DI 6904803-7 (22) 14/12/2009
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 23-04
39
RPI 2109 de 07/06/2011
(11) DI 6905091-0 (22) 29/12/2009
39
(15) 07/06/2011
(30) 02/07/2009 US 29/339,569
(45) 07/06/2011
(52)(BR) 09-01
(54) CONFIGURAÇÃO APLICADA EM PEÇA DE OMBRO PARA UM RECIPIENTE
(73) Colgate-Palmolive Company (US)
(72) Peter J. Fallat II, Bruce Cummings, Brian Worthington
(74) Momsen, Leonardos & Cia
Prazo de validade: 10 (dez) anos contados a partir de 29/12/2009, observadas as
condições legais.
DICIG - Publicação de Desenhos Industriais 155
(11) DI 6905166-6 (22) 12/11/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-09
(54) CONFIGURAÇÃO APLICADA EM TRAVESSEIRO
(73) Poliuretano do Brasil Industria e Comercio Ltda (BR/RS)
(72) Mauricio Tramontin
(74) Teresa Mariley Oliveira Abreu
Prazo de validade: 10 (dez) anos contados a partir de 12/11/2009, observadas as
condições legais.
(11) DI 6905214-0 (22) 14/08/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 25-01
(54) CONFIGURAÇÃO APLICADA EM PERFIL
(73) PAULO ROBERTO DELLA BARBA (BR/ES)
(72) PAULO ROBERTO DELLA BARBA
(74) DAVINO MARTINS DA SILVA FILHO
Prazo de validade: 10 (dez) anos contados a partir de 14/08/2009, observadas as
condições legais.
(11) DI 6905125-9 (22) 27/10/2009
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 21-01
(54) CONFIGURAÇÃO APLICADA EM PANELAS E TALHERES DE BRINQUEDO
(73) MIELLE INDÚSTRIA E COMÉRCIO DE PLÁSTICOS LTDA (BR/SP)
(72) ANDRÉ RODRIGO TAMASAUSKAS
(74) CLÓVIS VOESE
Prazo de validade: 10 (dez) anos contados a partir de 27/10/2009, observadas as
condições legais.
(11) DI 7000732-2 (22) 05/03/2010
(15) 07/06/2011
(30) 07/09/2009 EM DM/072.454
(45) 07/06/2011
39
156
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(52)(BR) 10-02
(54) CONFIGURAÇÃO APLICADA EM CAIXA DE RELÓGIO
(73) Cartier Creation Studio SA (CH)
(72) M. AURNAUD CHASTAING
(74) TINOCO SOARES & FILHO LTDA
Prazo de validade: 10 (dez) anos contados a partir de 05/03/2010, observadas as
condições legais.
(11) DI 7000759-4 (22) 08/03/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 11-02
(54) VASO FLEXIVEL
(73) Alexandre Galvão Queiroz (BR/SP)
(72) Alexandre Galvão Queiroz
Prazo de validade: 10 (dez) anos contados a partir de 08/03/2010, observadas as
condições legais.
(11) DI 7000916-3 (22) 16/03/2010
39
(15) 07/06/2011
(30) 17/09/2009 EM 001612805-0002; 23/02/2010 EM 001673385-0005
(45) 07/06/2011
(52)(BR) 15-04
(54) CONFIGURAÇÃO APLICADA EM CONJUNTO DE BRAÇOS CARREGADORES
PARA ESCAVADEIRA
(73) J.C. Bamford Excavators Limited (GB)
(72) Gary Edmund Major
(74) Momsen, Leonardos & Cia
Prazo de validade: 10 (dez) anos contados a partir de 16/03/2010, observadas as
condições legais.
(11) DI 7000917-1 (22) 16/03/2010
39
(15) 07/06/2011
(30) 23/02/2010 EM 001673385-0002; 23/02/2010 EM 001673385-0003
(45) 07/06/2011
(52)(BR) 15-04
(54) CONFIGURAÇÃO APLICADA EM CAPÔ PARA ESCAVADEIRA
(73) J.C. Bamford Excavators Limited (GB)
(72) Gary Edmund Major
(74) Momsen, Leonardos & Cia.
Prazo de validade: 10 (dez) anos contados a partir de 16/03/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 157
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-07
(54) CONFIGURAÇÃO APLICADA EM CONJUNTO DE TAMPAS DE ROSCA,
ENCAIXE OU OUTRAS
(73) Claudio Patrick Vollers (BR/RJ)
(72) Jefferson Luiz Miranda de Araujo, Claudio Patrick Vollers, Leonardo Garcia
Nogueira
Prazo de validade: 10 (dez) anos contados a partir de 07/06/2010, observadas as
condições legais.
(11) DI 7001387-0 (22) 12/04/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-07
(54) CONFIGURAÇÃO APLICADA EM SUPORTE DE PICOLÉ E SORVETE
(73) Industria e Comércio de Plásticos Cajovil Ltda (BR/SC)
(72) Jorge Luiz Brandes
(74) King's Marcas e Patentes Ltda
Prazo de validade: 10 (dez) anos contados a partir de 12/04/2010, observadas as
condições legais.
(11) DI 7002236-4 (22) 28/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-16
(54) CONFIGURAÇÃO APLICADA EM ACABAMENTO DE CAIXA DE CARGA
(73) Randon S/A Implementos e Participações (BR/RS)
(72) Valdir de Araújo Batista
(74) Vieira de Mello Advogados
Prazo de validade: 10 (dez) anos contados a partir de 28/05/2010, observadas as
condições legais.
(11) DI 7002423-5 (22) 07/06/2010
39
158
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 159
160
DICIG - Publicação de Desenhos Industriais
(11) DI 7002426-0 (22) 07/06/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-07
(54) CONFIGURAÇÃO APLICADA EM CONJUNTO DE TAMPAS DE ROSCA,
ENCAIXE OU OUTRAS
(73) Claudio Patrick Vollers (BR/RJ)
(72) Jefferson Luiz Miranda de Araujo, Claudio Patrick Vollers, Leonardo Garcia
Nogueira
Prazo de validade: 10 (dez) anos contados a partir de 07/06/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 161
162
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(11) DI 7002427-8 (22) 07/06/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-07
(54) CONFIGURAÇÃO APLICADA EM CONJUNTO DE TAMPAS DE ROSCA,
ENCAIXE OU OUTRAS
(73) Claudio Patrick Vollers (BR/RJ)
(72) Jefferson Luiz Miranda de Araujo, Claudio Patrick Vollers, Leonardo Garcia
Nogueira
Prazo de validade: 10 (dez) anos contados a partir de 07/06/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 163
164
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 165
(11) DI 7002428-6 (22) 07/06/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-07
(54) CONFIGURAÇÃO APLICADA EM CONJUNTO DE TAMPAS DE ROSCA,
ENCAIXE OU OUTRAS
(73) Claudio Patrick Vollers (BR/RJ)
(72) Jefferson Luiz Miranda de Araujo, Claudio Patrick Vollers, Leonardo Garcia
Nogueira
Prazo de validade: 10 (dez) anos contados a partir de 07/06/2010, observadas as
condições legais.
166
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 167
168
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(11) DI 7002538-0 (22) 09/06/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-03
(54) CONFIGURAÇÃO APLICADA A BONDE
(73) Rogério Foster Vidal (BR/RJ)
(72) Rogério Foster Vidal
(74) Bhering Advogados
Prazo de validade: 10 (dez) anos contados a partir de 09/06/2010, observadas as
condições legais.
(11) DI 7002695-5 (22) 21/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-02
(54) CONFIGURAÇÃO INTRODUZIDA EM CASACO COM CAPUZ
(73) ASSOCIAÇÃO DAS DAMAS DA CARIDADE DE S VICENTE DE PAULO
(BR/SP)
(72) MARIA CAMPOS FERREIRA
(74) SPI MARCAS & PATENTES S/C LTDA.
Prazo de validade: 10 (dez) anos contados a partir de 21/05/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7002696-3 (22) 28/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-02
(54) CONFIGURAÇÃO INTRODUZIDA EM CALÇA COMPRIDA
(73) ASSOCIAÇÃO DAS DAMAS DA CARIDADE DE S VICENTE DE PAULO
(BR/SP)
(72) MARIA CAMPOS FERREIRA
(74) SPI MARCAS & PATENTES S/C LTDA.
Prazo de validade: 10 (dez) anos contados a partir de 28/05/2010, observadas as
condições legais.
(11) DI 7002697-1 (22) 28/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-02
(54) CONFIGURAÇÃO INTRODUZIDA EM CALÇA CURTA
(73) ASSOCIAÇÃO DAS DAMAS DA CARIDADE DE S VICENTE DE PAULO
(BR/SP)
(72) MARIA CAMPOS FERREIRA
(74) SPI MARCAS & PATENTES S/C LTDA
Prazo de validade: 10 (dez) anos contados a partir de 28/05/2010, observadas as
condições legais.
DICIG - Publicação de Desenhos Industriais 169
(11) DI 7002698-0 (22) 28/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-02
(54) CONFIGURAÇÃO APLICADA EM CAMISETA DE MANGA CURTA
(73) ASSOCIAÇÃO DAS DAMAS DA CARIDADE DE S VICENTE DE PAULO
(BR/SP)
(72) MARIA CAMPOS FERREIRA
(74) SPI MARCAS & PATENTES S/C LTDA
Prazo de validade: 10 (dez) anos contados a partir de 28/05/2010, observadas as
condições legais.
(11) DI 7002699-8 (22) 28/05/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-02
(54) CONFIGURAÇÃO INTRODUZIDA EM CAMISETA DE MANGA LONGA
(73) ASSOCIAÇÃO DAS DAMAS DA CARIDADE DE S VICENTE DE PAULO
(BR/SP)
(72) MARIA CAMPOS FERREIRA
(74) SPI MARCAS & PATENTES S/C LTDA
Prazo de validade: 10 (dez) anos contados a partir de 28/05/2010, observadas as
condições legais.
(11) DI 7003262-9 (22) 20/08/2010
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
39
170
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(54) CONFIGURAÇÃO APLICADA À PORTA ESCOVA
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003263-7 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À FRASQUEIRA
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003264-5 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À MALETA
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003265-3 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À PORTA ÓCULOS
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003266-1 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À MOCHILA
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 171
(11) DI 7003344-7 (22) 26/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À ESTOJO
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 26/08/2010, observadas as
condições legais.
(11) DI 7003267-0 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À ESTOJO
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003907-0 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM TAÇA
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
(11) DI 7003268-8 (22) 20/08/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA À BALDE TÉRMICO
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 20/08/2010, observadas as
condições legais.
(11) DI 7003908-9 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM TAÇA
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
172
DICIG - Publicação de Desenhos Industriais
(11) DI 7003909-7 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM COPO
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
(11) DI 7003910-0 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM COPO
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7003911-9 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM SALADEIRA
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
(11) DI 7003912-7 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM SALADEIRA
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 173
(11) DI 7004084-2 (22) 13/10/2010
39
(15) 07/06/2011
(30) 14/04/2010 EM 001208698-0006
(45) 07/06/2011
(52)(BR) 23-02
(54) CONFIGURAÇÃO APLICADA A PISO PARA BOX DE BANHEIRO
(73) ROCA SANITARIO, S.A. (ES)
(72) MIGUEL ANGEL MUNAR SAURA
(74) ADVOCACIA PIETRO ARIBONI S/C
Prazo de validade: 10 (dez) anos contados a partir de 13/10/2010, observadas as
condições legais.
(11) DI 7003913-5 (22) 04/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 07-01
(54) CONFIGURAÇÃO APLICADA EM TAÇA
(73) Frederico Werner Strauss (BR/SC)
(72) Frederico Werner Strauss
(74) Anselmo Cardoso
Prazo de validade: 10 (dez) anos contados a partir de 04/10/2010, observadas as
condições legais.
(11) DI 7004083-4 (22) 13/10/2010
39
(15) 07/06/2011
(30) 14/04/2010 EM 001208698-0004
(45) 07/06/2011
(52)(BR) 23-02
(54) CONFIGURAÇÃO APLICADA A BANHEIRA
(73) ROCA SANITARIO, S.A. (ES)
(72) MIGUEL ANGEL MUNAR SAURA
(74) ADVOCACIA PIETRO ARIBONI S/C
Prazo de validade: 10 (dez) anos contados a partir de 13/10/2010, observadas as
condições legais.
(11) DI 7004085-0 (22) 13/10/2010
39
(15) 07/06/2011
(30) 14/04/2010 EM 001208698-0008
(45) 07/06/2011
(52)(BR) 23-02
(54) CONFIGURAÇÃO APLICADA A CONJUNTO DE VASO SANITÁRIO E BIDÊ
(73) ROCA SANITARIO, S.A. (ES)
(72) MIGUEL ANGEL MUNAR SAURA
(74) ADVOCACIA PIETRO ARIBONI S/C
Prazo de validade: 10 (dez) anos contados a partir de 13/10/2010, observadas as
condições legais.
174
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(11) DI 7004086-9 (22) 13/10/2010
39
(15) 07/06/2011
(30) 14/04/2010 EM 001208698-0010
(45) 07/06/2011
(52)(BR) 23-02
(54) CONFIGURAÇÃO APLICADA À PIA.
(73) ROCA SANITARIO, S.A. (ES)
(72) MIGUEL ANGEL MUNAR SAURA
(74) ADVOCACIA PIETRO ARIBONI S/C
Prazo de validade: 10 (dez) anos contados a partir de 13/10/2010, observadas as
condições legais.
(11) DI 7004158-0 (22) 15/10/2010
39
(15) 07/06/2011
(30) 16/04/2010 EM 001696683-0002; 16/04/2010 EM 001696683-0001
(45) 07/06/2011
(52)(BR) 13-03
(54) CONFIGURAÇÃO APLICADA EM PAINÉIS FRONTAIS PARA GABINETES
ELÉTRICOS
(73) Eaton Electric B.V (NL)
(72) TIM LIE
(74) ALEXANDRE FUKUDA YAMASHITA
Prazo de validade: 10 (dez) anos contados a partir de 15/10/2010, observadas as
condições legais.
(11) DI 7005313-8 (22) 08/11/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-05
(54) CONFIGURAÇÃO APLICADA EM ROLO TRANSPORTADOR
(73) Riberman Plásticos Industriais Ltda (BR/SP)
(72) David Queiroz
(74) Village Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 08/11/2010, observadas as
condições legais.
(11) DI 7005314-6 (22) 08/11/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-05
(54) CONFIGURAÇÃO APLICADA EM ROLO ELEVADOR
(73) Riberman Plásticos Industriais Ltda (BR/SP)
(72) David Queiroz
(74) Village Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 08/11/2010, observadas as
condições legais.
(11) DI 7005212-3 (22) 18/10/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-05
(54) CONFIGURAÇÃO APLICADA EM EMBALAGEM
(73) Ouro Fino Saúde Animal Ltda (BR/SP)
(72) Carlos Henrique Henrique
(74) Village Marcas & Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 18/10/2010, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7005368-5 (22) 21/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-01
(54) CONFIGURAÇÃO APLICADA EM FRASCO
(73) Shambelle Indústria e Comércio de Cosméticos Ltda (BR/MG)
(72) Gil Vicente Vieira Machado
(74) Maurício Ramos Damasceno
Prazo de validade: 10 (dez) anos contados a partir de 21/12/2010, observadas as
condições legais.
(11) DI 7005369-3 (22) 21/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-01
(54) CONFIGURAÇÃO APLICADA EM FRASCO
(73) Shambelle Indústria e Comércio de Cosméticos Ltda (BR/MG)
(72) Gil Vicente Vieira Machado
(74) Maurício Ramos Damasceno
Prazo de validade: 10 (dez) anos contados a partir de 21/12/2010, observadas as
condições legais.
DICIG - Publicação de Desenhos Industriais 175
(11) DI 7005373-1 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM CALÇADO
(73) DEUSDETE FERNANDES DOS SANTOS (BR/SP)
(72) DEUSDETE FERNANDES DOS SANTOS
(74) ALGO ALLIANCE ASSESSORIA EM PROPRIEDADE INTELECTUAL LTDA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005374-0 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM SOLADO
(73) INDÚSTRIA & COMÉRCIO DE CALÇADOS LOGUS LTDA (BR/SP)
(72) Helter Adriano da Silva
(74) ALGO ALLIANCE ASSESSORIA EM PROPRIEDADE INTELECTUAL LTDA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005375-8 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM SOLADO
(73) INDÚSTRIA & COMÉRCIO DE CALÇADOS LOGUS LTDA (BR/SP)
(72) Helter Adriano da Silva
(74) ALGO ALLIANCE ASSESSORIA EM PROPRIEDADE INTELECTUAL LTDA
176
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM SOLADO
(73) DIONES DO COUTO LOURENÇO SILVA (BR/SP)
(72) DIONES DO COUTO LOURENÇO SILVA
(74) MARCO ANTONIO DE OLIVEIRA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005376-6 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM CALÇADO
(73) DEUSDETE FERNANDES DOS SANTOS (BR/SP)
(72) DEUSDETE FERNANDES DOS SANTOS
(74) ALGO ALLIANCE ASSESSORIA EM PROPRIEDADE INTELECTUAL LTDA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005387-1 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 31-00
(54) CONFIGURAÇÃO ORNAMENTAL APLICADA EM CONJUNTO DE BATEDEIRA
COM TIGELA
(73) BRITANIA ELETRODOMÉSTICOS LTDA. (BR/PR)
(72) Cesar Eduardo Isaacson Buffara
(74) P A PRODUTORES ASSOCIADOS MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005378-2 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 30-99
(54) CONFIGURAÇÃO APLICADA EM PISTOLA PNEUMÁTICA
(73) GUIMES DE OLIVEIRA AFONSO (BR/SP) , JULIANO VENDRESQUI (BR/SP) ,
HÉLIO EURÍPIDES VENDRESQUI (BR/SP)
(72) GUIMES DE OLIVEIRA AFONSO, JULIANO VENDRESQUI, HÉLIO EURÍPIDES
VENDRESQUI
(74) MARCO ANTONIO DE OLIVEIRA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005388-0 (22) 20/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 09-01
(54) CONFIGURAÇÃO APLICADA EM FRASCO
(73) JOAQUIM ALFREDO GOMES DA COSTA (BR/SP)
(72) JOAQUIM ALFREDO GOMES DA COSTA
(74) AGUINALDO MOREIRA
Prazo de validade: 10 (dez) anos contados a partir de 20/12/2010, observadas as
condições legais.
(11) DI 7005379-0 (22) 20/12/2010
(15) 07/06/2011
39
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 177
(11) DI 7100050-0 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7005512-2 (22) 22/12/2010
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 25-01
(54) CONFIGURAÇÃO APLICADA EM PROTETOR DE BORDA DE DEGRAUS
(73) METAL PINT , S.R.L. (AR)
(72) FERNANDO RODRIGO HERNANDEZ
(74) MILTON PIONTE
Prazo de validade: 10 (dez) anos contados a partir de 22/12/2010, observadas as
condições legais.
(11) DI 7100051-8 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100049-6 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100052-6 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
178
DICIG - Publicação de Desenhos Industriais
RPI 2109 de 07/06/2011
(11) DI 7100055-0 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100053-4 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100056-9 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100054-2 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100057-7 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7100059-3 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100061-5 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
DICIG - Publicação de Desenhos Industriais 179
(11) DI 7100062-3 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100063-1 (22) 07/01/2011
39
(15) 07/06/2011
(30) 09/07/2010 US 29/365,515
(45) 07/06/2011
(52)(BR) 01-01
(54) CONFIGURAÇÃO APLICADA À BARRA DE CHOCOLATE
(73) MARS, INCORPORATED (US)
(72) KIRK FUJIOKA, CHITHRA P. PANCHAPAKESAN, WILLIAM JASON GREER,
BRUCE HANNANT
(74) VEIRANO E ADVOGADOS ASSOCIADOS
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
180
DICIG - Publicação de Desenhos Industriais
(11) DI 7100064-0 (22) 07/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-01
(54) CONFIGURAÇÃO APLICADA EM ASSENTO
(73) FENG YUE (CN)
(72) FENG YUE
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/01/2011, observadas as
condições legais.
(11) DI 7100067-4 (22) 10/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 06-06
(54) CONFIGURAÇÃO APLICADA EM BRAÇO PARA SOFÁ
(73) `D´Talh´s Indústria e Comércio de Móveis e Acessórios Ltda (BR/PB)
(72) Polyany Kylcy Ferreira Mateus
(74) Francisco Leite de Oliveira Filho
Prazo de validade: 10 (dez) anos contados a partir de 10/01/2011, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7100069-0 (22) 10/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 15-04
(54) CONFIGURAÇÃO APLICADA EM MÁQUINA NIVELADORA
(73) GTS do Brasil Ltda (BR/SC)
(72) Assis Strasser, Aldivio Strasser
(74) Valor Marcas e Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 10/01/2011, observadas as
condições legais.
(11) DI 7100070-4 (22) 10/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO ORNAMENTAL APLICADA EM CALÇADO
(73) Indústria de Calçados Vivo Ltda (BR/RS)
(72) Gilmar Frederico de Cesero
(74) Capella & Veloso Associados Ltda
Prazo de validade: 10 (dez) anos contados a partir de 10/01/2011, observadas as
condições legais.
(11) DI 7100068-2 (22) 10/01/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-08
(54) CONFIGURAÇÃO APLICADA EM CARROCERIA
(73) GTS do Brasil Ltda (BR/SC)
(72) Assis Strasser, Aldivio Strasser
(74) Valor Marcas e Patentes S/S Ltda
Prazo de validade: 10 (dez) anos contados a partir de 10/01/2011, observadas as
condições legais.
(11) DI 7100071-2 (22) 10/01/2011
(15) 07/06/2011
(45) 07/06/2011
39
RPI 2109 de 07/06/2011
(52)(BR) 09-03
(54) CONFIGURAÇÃO APLICADA EM CONTENTOR
(73) Marcelo Sanches Grandi (BR/RS)
(72) Marcelo Sanches Grandi
(74) Mario de Almeida Marcas e Patentes Ltda
Prazo de validade: 10 (dez) anos contados a partir de 10/01/2011, observadas as
condições legais.
DICIG - Publicação de Desenhos Industriais 181
(11) DI 7100310-0 (22) 01/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 12-16
(54) CONFIGURAÇÃO ORNAMENTAL APLICADA EM APARA-BARRO PARA
MOTOCICLETAS EM GERAL
(73) JOSÉ DELENA NETO (BR/SP)
(72) JOSÉ DELENA NETO
(74) CLAUDINEY DE ANGELO
Prazo de validade: 10 (dez) anos contados a partir de 01/02/2011, observadas as
condições legais.
(11) DI 7100349-5 (22) 07/02/2011
39
(15) 07/06/2011
(30) 05/08/2010 KR 30-2010-0034136
(45) 07/06/2011
(52)(BR) 14-03
(54) CONFIGURAÇÃO APLICADA EM AUTO-FALANTE
(73) LG ELECTRONICS INC. (KR)
(72) JIYEON LEE, SUNGGU JOE, SUNGHOON OH
(74) DAVID DO NASCIMENTO ADVOGADOS ASSOCIADOS
Prazo de validade: 10 (dez) anos contados a partir de 07/02/2011, observadas as
condições legais.
(11) DI 7100350-9 (22) 07/02/2011
39
(15) 07/06/2011
(30) 05/08/2010 KR 30-2010-0034135
(45) 07/06/2011
(52)(BR) 14-03
(54) CONFIGURAÇÃO APLICADA EM AUTO-FALANTE
(73) LG ELECTRONICS INC. (KR)
(72) JIYEON LEE, SUNGGU JOE, SUNGHOON OH
(74) DAVID DO NASCIMENTO ADVOGADOS ASSOCIADOS
Prazo de validade: 10 (dez) anos contados a partir de 07/02/2011, observadas as
condições legais.
182
DICIG - Publicação de Desenhos Industriais
(11) DI 7100351-7 (22) 07/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 08-08
(54) CONFIGURAÇÃO APLICADA EM PRENDEDOR DE TOALHAS
(73) GUOQIANG CHEN (BR/SP)
(72) GUOQIANG CHEN
(74) DIFUSÃO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 07/02/2011, observadas as
condições legais.
(11) DI 7100384-3 (22) 10/02/2011
39
(15) 07/06/2011
(30) 13/08/2010 KR 30-2010-0035366
(45) 07/06/2011
(52)(BR) 14-03
(54) CONFIGURAÇÃO APLICADA EM TELEFONE CELULAR
(73) LG ELECTRONICS, INC. (KR)
(72) HYUNSEUNG SEO, JAEYOUNG KIM, JIHOON SHIN
(74) SÍMBOLO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 10/02/2011, observadas as
condições legais.
RPI 2109 de 07/06/2011
(11) DI 7100393-2 (22) 11/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 03-01
(54) CONFIGURAÇÃO APLICADA A FRASQUEIRA
(73) EMILIO RAMPAZZO (BR/SP)
(72) EMILIO RAMPAZZO
Prazo de validade: 10 (dez) anos contados a partir de 11/02/2011, observadas as
condições legais.
(11) DI 7100401-7 (22) 14/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 11-01
(54) CONFIGURAÇÃO APLICADA EM BRACELETE
(73) CARINA CORTE (BR/SP)
(72) CARINA CORTE
Prazo de validade: 10 (dez) anos contados a partir de 14/02/2011, observadas as
condições legais.
RPI 2109 de 07/06/2011
DICIG - Publicação de Desenhos Industriais 183
(72) EUN-SUK LEE
(74) ADVOCACIA PIETRO ARIBONI S/C
Prazo de validade: 10 (dez) anos contados a partir de 14/02/2011, observadas as
condições legais.
(11) DI 7100403-3 (22) 14/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 28-03
(54) CONFIGURAÇÃO APLICADA EM BICO ALISADOR/MODELADOR
(73) GUOQIANG CHEN (BR/SP)
(72) GUOQIANG CHEN
(74) DIFUSÃO MARCAS E PATENTES LTDA
Prazo de validade: 10 (dez) anos contados a partir de 14/02/2011, observadas as
condições legais.
(11) DI 7100404-1 (22) 14/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 14-03
(54) CONFIGURAÇÃO APLICADA A COMPUTADOR PESSOAL COM TRÊS
MONITORES
(73) EUN-SUK LEE (KR)
(11) DI 7100405-0 (22) 14/02/2011
39
(15) 07/06/2011
(45) 07/06/2011
(52)(BR) 02-04
(54) CONFIGURAÇÃO APLICADA EM CALÇADO
(73) URIAS FRANCISCO CINTRA (BR/SP)
(72) URIAS FRANCISCO CINTRA
(74) BEERRE ASSESSORIA EMPRESARIAL LTDA
Prazo de validade: 10 (dez) anos contados a partir de 14/02/2011, observadas as
condições legais.
Diretoria de Contratos, Indicações Geográficas e
Registros - DICIG
Despachos Relativos a Pedidos e Registros de
Desenho Industrial
RPI 2109 de 07/06/2011
41
NULIDADE ADMINISTRATIVA
(11) DI 6704674-6 (15) 01/06/2010 41
(73) Nike International Ltd (US)
(74) Antonio Mauricio Pedras Arnaud
INPI/DICIG
NULIDADE INSTAURADA EM 30/03/2011.
(11) DI 6705212-6 (15) 01/09/2009 41
(73) VERA LÚCIA BEZERRA ALVES ME (BR/RN)
INPI/DICIG
NULIDADE INSTAURADA EM 30/03/2011.
(